Recombinant Human Maleylacetoacetate Isomerase/MAA/GSTZ1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 50mM TrisHCl, 1mM DTT, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRALEHHHHHH |
Source: E.coli.
MW :25.18kD.
Recombinant Human Glutathione S-Transferase Zeta 1 is produced by our E.coli expression system and the target gene encoding Met1-Ala216 is expressed with a 6His tag at the C-terminus. Maleylacetoacetate Isomerase (MAAI) belongs to the Glutathione S-Transferase super-family. MAAI encodes multifunctional enzymes in the detoxification of electrophilic molecules by conjugation with glutathione, for example, mutagens, carcinogens and several therapeutic drugs. MAAI is a bifunctional protein with low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. MAAI can catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid. But it has minimal glutathione-conjugating activity with 7-chloro-4-nitrobenz-2-oxa-1, ethacrynic acid 3-diazole and maleylacetoacetate isomerase activity.
MW :25.18kD.
Recombinant Human Glutathione S-Transferase Zeta 1 is produced by our E.coli expression system and the target gene encoding Met1-Ala216 is expressed with a 6His tag at the C-terminus. Maleylacetoacetate Isomerase (MAAI) belongs to the Glutathione S-Transferase super-family. MAAI encodes multifunctional enzymes in the detoxification of electrophilic molecules by conjugation with glutathione, for example, mutagens, carcinogens and several therapeutic drugs. MAAI is a bifunctional protein with low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. MAAI can catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid. But it has minimal glutathione-conjugating activity with 7-chloro-4-nitrobenz-2-oxa-1, ethacrynic acid 3-diazole and maleylacetoacetate isomerase activity.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Tissue Specificity: | Mostly expressed in liver followed by kidney, skeletal muscle and brain. Also expressed in melanocytes, synovium, placenta, breast and fetal liver and heart. |
| BioGrid: | 109209. 8 interactions. |
|
There are currently no product reviews
|




















.png)










