Recombinant Human Nogo-A/Reticulon-4/RTN4 (N-GST)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLEELEVLERKPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAPSPLSAAAVSPSKLPEDDEPPARPPPPPPASVSPQAEPVWTPPAPAPAAPPSTPAAPKRRGSSGSV |
Source: E. coli.
MW :45.5kD.
Recombinant Human Reticulon-4 is produced by our E.coli expression system and the target gene encoding Met1-Val185 is expressed with a GST tag at the N-terminus. RTN4 belongs to multiple-pass membrane peotein, which anchored to the membrane of the endoplasmic reticulum through 2 putative transmembrane domains. It acts as a developmental neurite growth regulatory factor with a roles as a negative regulator of axon-axon adhesion and growth. RTN4 regulates neurite fasciculation, branching and extension in the developing nervous system. It involved in down-regulation of growth, stabilization of wring and restriction of plasticity in the adult CNS. It regulates the radial migration of cortical neurons via an RTN4R-Lingo1 containing receptor complex.
MW :45.5kD.
Recombinant Human Reticulon-4 is produced by our E.coli expression system and the target gene encoding Met1-Val185 is expressed with a GST tag at the N-terminus. RTN4 belongs to multiple-pass membrane peotein, which anchored to the membrane of the endoplasmic reticulum through 2 putative transmembrane domains. It acts as a developmental neurite growth regulatory factor with a roles as a negative regulator of axon-axon adhesion and growth. RTN4 regulates neurite fasciculation, branching and extension in the developing nervous system. It involved in down-regulation of growth, stabilization of wring and restriction of plasticity in the adult CNS. It regulates the radial migration of cortical neurons via an RTN4R-Lingo1 containing receptor complex.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Endoplasmic reticulum membrane |
| Tissue Specificity: | Isoform 1 is specifically expressed in brain and testis and weakly in heart and skeletal muscle. Isoform 2 is widely expressed except for the liver. Isoform 3 is expressed in brain, skeletal muscle and adipocytes. Isoform 4 is testis-specific. |
| BioGrid: | 121400. 113 interactions. |
|
There are currently no product reviews
|












.png)











