Recombinant Human Nuclear Transcription Factor Y Subunit a/NFYA
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYNRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS |
Source: E. coli.
MW :33.9kD.
Recombinant Human Nuclear TF Y subunit alpha is produced by our E.coli expression system and the target gene encoding Met1-Ser318 is expressed. Nuclear Transcription Factor Y Subunit a (NFYA) is a member of the NFYA/HAP2 subunit family. NFYA founctions as a heterotrimeric transcription factor , which is composed of three components, NF-YA, NF-YB and NF-YC, binds to CCAAT motifs in the promoter regions in a variety of genes. NFYA forms a highly conserved transcription factor which stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.
MW :33.9kD.
Recombinant Human Nuclear TF Y subunit alpha is produced by our E.coli expression system and the target gene encoding Met1-Ser318 is expressed. Nuclear Transcription Factor Y Subunit a (NFYA) is a member of the NFYA/HAP2 subunit family. NFYA founctions as a heterotrimeric transcription factor , which is composed of three components, NF-YA, NF-YB and NF-YC, binds to CCAAT motifs in the promoter regions in a variety of genes. NFYA forms a highly conserved transcription factor which stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus |
| BioGrid: | 110866. 56 interactions. |
|
There are currently no product reviews
|














.png)







