Recombinant Human Nucleolar Protein 3/NOL3 (His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 25mM TrisHCl, 1mM DTT, 1mM EDTA, 2mM beta-ME, 20% Glycerol, pH 7.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS |
Source: E.coli.
MW :22.63kD.
Recombinant Human Nucleolar Protein 3 is produced by our E.coli expression system and the target gene encoding Met1-Ser208 is expressed. Nucleolar protein 3 is encoded by NOL3 gene. Multiple transcript variants encoding different isoforms have been found for this gene. So far, Nucleolar protein 3 has show to have two Isoforms. Isoform 1 may be involved in RNA splicing.Isoform 2 may inhibit apoptosis.It has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53.
MW :22.63kD.
Recombinant Human Nucleolar Protein 3 is produced by our E.coli expression system and the target gene encoding Met1-Ser208 is expressed. Nucleolar protein 3 is encoded by NOL3 gene. Multiple transcript variants encoding different isoforms have been found for this gene. So far, Nucleolar protein 3 has show to have two Isoforms. Isoform 1 may be involved in RNA splicing.Isoform 2 may inhibit apoptosis.It has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Mitochondrion, Sarcoplasmic reticulum, Membrane |
| Post transnational modification: | Polyubiquitinated by MDM2; promoting proteasomal-dependent degradation in response to apoptotic stimuli. |
| Tissue Specificity: | Highly expressed in heart and skeletal muscle. Detected at low levels in placenta, liver, kidney and pancreas. |
| BioGrid: | 114477. 37 interactions. |
|
There are currently no product reviews
|












.png)












