Recombinant Human Partner of Y14 and Mago/WIBG /PYM (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, 10% Glycerol, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGLLEHHHHHH |
Source: E.coli.
MW :23.7kD.
Recombinant Human Partner of Y14 and Mago is produced by our E.coli expression system and the target gene encoding Met1-Leu204 is expressed with a 6His tag at the C-terminus. Partner of Y14 and Mago (WIBG) is a key regulator of the Exon Junction Complex (EJC). EJC is a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs, is a positional landmarker for the intron exon structure of genes, and directs post-transcriptional processes in the cytoplasm, for instance mRNA export, nonsense-mediated mRNA decay or translation. WIBG is a cytoplasmic RNA-binding protein, it can be excluded from nucleus by Crm1. WIBG as a cooperateing partner of Mago-14, relates with Mago-14 by its N-terminal domain.
MW :23.7kD.
Recombinant Human Partner of Y14 and Mago is produced by our E.coli expression system and the target gene encoding Met1-Leu204 is expressed with a 6His tag at the C-terminus. Partner of Y14 and Mago (WIBG) is a key regulator of the Exon Junction Complex (EJC). EJC is a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs, is a positional landmarker for the intron exon structure of genes, and directs post-transcriptional processes in the cytoplasm, for instance mRNA export, nonsense-mediated mRNA decay or translation. WIBG is a cytoplasmic RNA-binding protein, it can be excluded from nucleus by Crm1. WIBG as a cooperateing partner of Mago-14, relates with Mago-14 by its N-terminal domain.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus, Nucleus |
| BioGrid: | 124031. 79 interactions. |
|
There are currently no product reviews
|














.png)









