Recombinant Human Rho GTPase-Activating Protein 25/ARHGAP25 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20 mMTrisHCl, pH 7.5,1 mM DTT, 5 mM MgCl2. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDIPLSPPAQKNDPKKAPVARSSVGWDATEDLRISRTDSFSSMVRCREPSCFHWVLPLVQAIPCKACSRVAIWGVLGDAVAVGAAATDSSEHTLKAWPLSKSSFYWHLVDHHHHHH |
Source: Human Cells.
MW :52.8kD.
Recombinant Human ARHGAP25 is produced by our Mammalian expression system and the target gene encoding Met1-Leu458 is expressed with a 6His tag at the C-terminus. Human ARHGAP25, also known as Rho GTPase-activating protein 25, Rho-type GTPase-activating protein 25 and KIAA0053, is a 648 amino acid protein. It contains one PH domain and one Rho-GAP domain. ARHGAP25 encode negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration. ARHGAP25 is GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
MW :52.8kD.
Recombinant Human ARHGAP25 is produced by our Mammalian expression system and the target gene encoding Met1-Leu458 is expressed with a 6His tag at the C-terminus. Human ARHGAP25, also known as Rho GTPase-activating protein 25, Rho-type GTPase-activating protein 25 and KIAA0053, is a 648 amino acid protein. It contains one PH domain and one Rho-GAP domain. ARHGAP25 encode negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration. ARHGAP25 is GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| BioGrid: | 115264. 30 interactions. |
|
There are currently no product reviews
|
















.png)









