Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
      • Cell Lines
        • Primary Cells
        • Reporter Cell Lines
        • Stable Cell Lines
      • Kits and Reagents
        • Inhibitor Screening Kit
        • Molecular Biology Kits
        • ELISA Kits
        • Apoptosis Detection kits
        • Luciferase reporter assay kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Immune-Check Point
      • Tissue Microarray
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. SARS-CoV-2 Spike protein (S1) Tag-free

SARS-CoV-2 Spike protein (S1) Tag-free

Share:

Figure-1: SARS-CoV-2 Spike protein (S1) can bind with Human ACE2 in functional ELISA assay.

SARS-CoV-2 Spike protein (S1) Tag-free

Roll over image to zoom in

   

Product code: 32-18023

Application : Functional Assay, ELISA

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   100 μg

  •  1 mg

  • $616.00 

  • $2,443.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Format : Purified
Amount : 1 mg
Purification : > 85% as analyzed by SDS-PAGE
Content : PBS, pH 7.4
Storage condition : The product can be stored at -20°C or below. Avoid repeated freezing and thawing cycles. The shelf life of the product is unspecified.
AA sequence : QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR
Uniprot ID : QHD43416.1

Source: Human cells. SARS-CoV-2 (Severe Acute Respiratory Syndrome Coronavirus 2) also known as 2019-nCoV (2019 Novel Coronavirus) is a virus that causes illnesses ranging from the common cold to severe diseases. SARS-CoV-2 Spike Protein is composed of S1 domain and S2 domain. S1 contains a receptor-binding domain (RBD) that can specifically bind to angiotensin-converting enzyme 2 (ACE2), the receptor on target cells. S protein plays an important role in the induction of neutralizing-antibodies and T-cell responses, as well as protective immunity. Predicted molecular weight 78.3 kDa.

 

ELISA, SARS-CoV-2 Spike protein (S1) can bind with Human ACE2 in functional ELISA assay.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

2019-nCoV Nucleocapsid Antibody (Humanized)

2019-nCoV Nucleocapsid Antibod...

details-2019-nCoV Nucleocapsid Antibody (Humanized)
Anti-Squamous Cell Carcinoma Antigen 1 Monoclonal Antibody(Clone: CPTC-SERPINB3-2)

Anti-Squamous Cell Carcinoma A...

details-Anti-Squamous Cell Carcinoma Antigen 1 Monoclonal Antibody(Clone: CPTC-SERPINB3-2)
Anti-S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) Monoclonal Antibody(Clone: S100A4/1482)

Anti-S100A4 / Metastasin / Cal...

details-Anti-S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) Monoclonal Antibody(Clone: S100A4/1482)
2019-nCoV Nucleocapsid Protein

2019-nCoV Nucleocapsid Protein

details-2019-nCoV Nucleocapsid Protein
SARS-CoV Spike Antibody, Rabbit pAb (Cross react with RBD domain)

SARS-CoV Spike Antibody, Rabbi...

details-SARS-CoV Spike Antibody, Rabbit pAb (Cross react with RBD domain)
SARS-CoV-2 Neutralizing Antibodies Detection Kit

SARS-CoV-2 Neutralizing Antibo...

details-SARS-CoV-2 Neutralizing Antibodies Detection Kit
Coronavirus (COVID-19) Spike Antibody (Clone: ABM19C9)

Coronavirus (COVID-19) Spike A...

details-Coronavirus (COVID-19) Spike Antibody (Clone: ABM19C9)
Anti-Spectrin beta III (SPTBN2) Monoclonal Antibody(Clone: SPTBN2/2894R)

Anti-Spectrin beta III (SPTBN2...

details-Anti-Spectrin beta III (SPTBN2) Monoclonal Antibody(Clone: SPTBN2/2894R)
Monoclonal Antibody to Galectin-8 (clone:106.1)

Monoclonal Antibody to Galecti...

details-Monoclonal Antibody to Galectin-8 (clone:106.1)
anti-ACE2 (human), mAb (blocking) (AC384) Azide free

anti-ACE2 (human), mAb (blocki...

details-anti-ACE2 (human), mAb (blocking) (AC384) Azide free
Recombinant Sars-Cov-2 (COVID-19/2019-nCov) Spike RBD Protein

Recombinant Sars-Cov-2 (COVID-...

details-Recombinant Sars-Cov-2 (COVID-19/2019-nCov) Spike RBD Protein
Anti-RAD51 (Prognostic and Response to Chemotherapy Marker) Monoclonal Antibody(Clone: RAD51/2753)

Anti-RAD51 (Prognostic and Res...

details-Anti-RAD51 (Prognostic and Response to Chemotherapy Marker) Monoclonal Antibody(Clone: RAD51/2753)
Anti-Spectrin Alpha 1 (Erythrocyte Marker) Monoclonal Antibody(Clone: SPTA1/1810)

Anti-Spectrin Alpha 1 (Erythro...

details-Anti-Spectrin Alpha 1 (Erythrocyte Marker) Monoclonal Antibody(Clone: SPTA1/1810)
Anti-CD45 / LCA (Leucocyte Marker) Monoclonal Antibody(Clone: SPM569 + SPM570)-FITC

Anti-CD45 / LCA (Leucocyte Mar...

details-Anti-CD45 / LCA (Leucocyte Marker) Monoclonal Antibody(Clone: SPM569 + SPM570)-FITC

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Peroxidase conjugated Goat anti Mouse IgG (H+L)

Peroxidase conjugated Goat anti Mou...

details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

Related Products

Recombinant Human Ankyrin Repeat and SOCS Box Protein 13/ASB13 (N-6His)

Recombinant Human Ankyrin Repeat and SOCS Box Protein 13/ASB13 (N-6His)

Recombinant Human Follistatin-Related Protein 1/FSTL1 (C-6His)(Discontinued)

Recombinant Human Follistatin-Related Protein 1/FSTL1 (C-6His)(Discontinued)

Recombinant Human Hepatocyte Growth Factor/HGF/Hepatopoietin-A (C-6His)(Discontinued)

Recombinant Human Hepatocyte Growth Factor/HGF/Hepatopoietin-A (C-6His)(Discontinued)

New Products

SARS-CoV-2 Spike S1 Mutant Sampler Set

SARS-CoV-2 Spike S1 Mutant Sampler Set

SARS-CoV-2 (2019-nCoV) Spike S1(D614G)- His Tag Protein

SARS-CoV-2 (2019-nCoV) Spike S1(D614G)- His Tag Protein

SARS-CoV-2 (2019-nCoV) Spike S1(N439K)- His Tag Protein

SARS-CoV-2 (2019-nCoV) Spike S1(N439K)- His Tag Protein

close

Please Login to write a Review !!


close

SARS-CoV-2 Spike protein (S1) Tag-free

Product code: 32-18023
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • recmAb™
  • Cell Lines
  • Kits and Reagents
  • Immune-Check Point
  • Tissue Microarray
  • Ligands and Inhibitors
  • Recombinant Proteins

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2021 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart