SARS-CoV-2 Spike protein (S1) Tag-free
Figure-1: SARS-CoV-2 Spike protein (S1) can bind with Human ACE2 in functional ELISA assay.
Roll over image to zoom in
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Format : | Purified |
| Amount : | 1 mg |
| Purification : | > 85% as analyzed by SDS-PAGE |
| Content : | PBS, pH 7.4 |
| Storage condition : | The product can be stored at -20°C or below. Avoid repeated freezing and thawing cycles. The shelf life of the product is unspecified. |
| AA sequence : | QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR |
| Uniprot ID : | QHD43416.1 |
Source: Human cells. SARS-CoV-2 (Severe Acute Respiratory Syndrome Coronavirus 2) also known as 2019-nCoV (2019 Novel Coronavirus) is a virus that causes illnesses ranging from the common cold to severe diseases. SARS-CoV-2 Spike Protein is composed of S1 domain and S2 domain. S1 contains a receptor-binding domain (RBD) that can specifically bind to angiotensin-converting enzyme 2 (ACE2), the receptor on target cells. S protein plays an important role in the induction of neutralizing-antibodies and T-cell responses, as well as protective immunity. Predicted molecular weight 78.3 kDa.
ELISA, SARS-CoV-2 Spike protein (S1) can bind with Human ACE2 in functional ELISA assay.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|


















.png)







