Recombinant Human Secreted and Transmembrane Protein 1/SECTM1/CD7L/K12 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGVDHHHHHH |
MW :13.75kD.
Recombinant Human Secreted and Transmembrane Protein 1 is produced by our Mammalian expression system and the target gene encoding Gln29-Gly145 is expressed with a 6His tag at the C-terminus. Secreted and Transmembrane Protein 1 (SECTM1) is a transmembrane and secreted protein that belongs to the SECTM family. SECTM1 is expressed in a perinuclear Golgi-like pattern. It is detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. SECTM1 is considered to participate in thymocyte signaling and the hematopoietic/immune system processes. It is reported that SECTM1 is a broadly expressed, IFN- gamma -inducible molecule, which functions as a potent costimulatory ligand for T cell activation and is synergistic with anti-CD28.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Cell membrane, Secreted |
Tissue Specificity: | Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes. Expressed in thymic epithelial cells and fibroblasts. |
BioGrid: | 112298. 1 interactions. |
There are currently no product reviews
|