Recombinant Human Tumor Necrosis Factor Receptor II/TNFRSF1B/CD120b (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDVDHHHHHH |
Source: Human Cells.
MW :26.2kD.
Recombinant Human Tumor Necrosis Factor Receptor II is produced by our Mammalian expression system and the target gene encoding Leu23-Asp257 is expressed with a 6His tag at the C-terminus. Tumor necrosis factor receptor superfamily member 1B is a 461 amino acids protein that belongs to the TNFR (tumor necrosis factor receptor) superfamily characterized by cysteine-rich extracellular domains. It contains 4 TNFR-Cys repeats. TNFRII is expressed in fetal brain. TNFRII is strongly expressed at the cartilage-pannus junction, and plays a major role in a subset of families with multiple cases of rheumatoid arthritis (RA). This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
MW :26.2kD.
Recombinant Human Tumor Necrosis Factor Receptor II is produced by our Mammalian expression system and the target gene encoding Leu23-Asp257 is expressed with a 6His tag at the C-terminus. Tumor necrosis factor receptor superfamily member 1B is a 461 amino acids protein that belongs to the TNFR (tumor necrosis factor receptor) superfamily characterized by cysteine-rich extracellular domains. It contains 4 TNFR-Cys repeats. TNFRII is expressed in fetal brain. TNFRII is strongly expressed at the cartilage-pannus junction, and plays a major role in a subset of families with multiple cases of rheumatoid arthritis (RA). This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | A soluble form (tumor necrosis factor binding protein 2) is produced from the membrane form by proteolytic processing. |
| BioGrid: | 112987. 26 interactions. |
|
There are currently no product reviews
|

















.png)










