Recombinant Human Vaccinia-Related Kinase 3/VRK3 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLDAKDGRLFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVHQDKYRFLVLPSLGRSLQSALDVSPKHVLSERSVLQVACRLLDALEFLHENEYVHGNVTAENIFVDPEDQSQVTLAGYGFAFRYCPSGKHVAYVEGSRSPHEGDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPWTNCLPNTEDIMKQKQKLPWDSFVDHHHHHH |
Source: Human Cells.
MW :46.9kD.
Recombinant Human Vaccinia-related kinase 3 is produced by our Mammalian expression system and the target gene encoding Met1-Phe412 is expressed with a 6His tag at the C-terminus. Inactive serine/threonine-protein kinase VRK3 is a 474 amino acids protein that belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family and VRK subfamily. It contains a protein kinase domain. VRK3 is widely expressed in human tissues and the protein localizes to the nucleus. VRK3 regulates several transcription factors, nuclear envelope assembly, and chromatin condensation and is also required for cell cycle progression .
MW :46.9kD.
Recombinant Human Vaccinia-related kinase 3 is produced by our Mammalian expression system and the target gene encoding Met1-Phe412 is expressed with a 6His tag at the C-terminus. Inactive serine/threonine-protein kinase VRK3 is a 474 amino acids protein that belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family and VRK subfamily. It contains a protein kinase domain. VRK3 is widely expressed in human tissues and the protein localizes to the nucleus. VRK3 regulates several transcription factors, nuclear envelope assembly, and chromatin condensation and is also required for cell cycle progression .
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus |
| BioGrid: | 119394. 12 interactions. |
|
There are currently no product reviews
|










.png)








