Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Human Xaa-Pro Aminopeptidase P3/XPNPEP3 (N, C-6His)

Recombinant Human Xaa-Pro Aminopeptidase P3/XPNPEP3 (N, C-6His)

Share:

Fig-1: Recombinant Human Xaa-Pro Aminopeptidase P3 was run on a 4-20% SDS-PAGE gel followed by Coomassie blue staining.

Recombinant Human Xaa-Pro Aminopeptidase P3/XPNPEP3 (N, C-6His)

Roll over image to zoom in

   

Product code: 32-8113

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $319.00 

  • $573.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • More
  • Review   (0)
Amount : 50 µg
Content : Supplied as Lyophilized from a 0.2 µm filtered solution in PBS with 5% trehalose, pH 7.4 Reconstitute sterile water.
Storage condition : Store at -20°C, stable for 12 months as lyophilized, 2-8 oC for 1 month under sterile condition after reconstitution. Please minimize freeze-thaw cycles.
AA sequence : MGSSHHHHHHSSGLVPRGSHMPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPFILSADCPKEMNDIEQICSQASLEHHHHHH
Gene : XPNPEP3
Gene ID : 63929
Uniprot ID : Q9NQH7

Source: E. coli.
MW :55.7kD.
Recombinant Human Aminopeptidase P3 is produced by our E.coli expression system and the target gene encoding Met1-Ser507 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. Probable Xaa-Pro Aminopeptidase 3 (XPNPEP3) is a member of the peptidase M24B family. XPNPEP3 has two isoforms and both are widely expressed. XPNPEP3 is localized in the Mitochondrion. XPNPEP3 catalyzes the release of any N-terminal amino acid, including proline, that is linked to proline, even from a dipeptide or tripeptide. Defects in XPNPEP3 are the cause of nephronophthisis-like nephropathy type 1 which is a disorder with features of nephronophthisis, a cystic kidney disease leading to end-stage renal failure.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Mitochondrion
Tissue Specificity: Isoform 1 and isoform 2 are widely expressed, with isoform 1 being more abundant.
BioGrid: 121997. 27 interactions.
There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Monoclonal Antibody to Nuclear pore complex(Clone: 39C7)

Monoclonal Antibody to Nuclear...

details-Monoclonal Antibody to Nuclear pore complex(Clone: 39C7)
Anti-NKG2D Antibody (tesnatilimab biosimilar) (JNJ-64304500)

Anti-NKG2D Antibody (tesnatili...

details-Anti-NKG2D Antibody (tesnatilimab biosimilar) (JNJ-64304500)
DNALI1 Recombinant Protein

DNALI1 Recombinant Protein

details-DNALI1 Recombinant Protein
Recombinant human CSF2RA protein with C-terminal human Fc tag

Recombinant human CSF2RA prote...

details-Recombinant human CSF2RA protein with C-terminal human Fc tag
Recombinant human IL18 protein with C-terminal human Fc tag

Recombinant human IL18 protein...

details-Recombinant human IL18 protein with C-terminal human Fc tag
Monoclonal Antibody to HLA-DRB (MHC II)(Clone : HLA-DRB/1067)

Monoclonal Antibody to HLA-DRB...

details-Monoclonal Antibody to HLA-DRB (MHC II)(Clone : HLA-DRB/1067)
ABO Recombinant Protein

ABO Recombinant Protein

details-ABO Recombinant Protein
Anti-HSP60 Monoclonal Antibody (Clone : LK2) FITC

Anti-HSP60 Monoclonal Antibody...

details-Anti-HSP60 Monoclonal Antibody (Clone : LK2) FITC
Recombinant human ERG protein with C-terminal human Fc tag

Recombinant human ERG protein ...

details-Recombinant human ERG protein with C-terminal human Fc tag
Recombinant human ADORA2B protein with C-terminal human Fc tag

Recombinant human ADORA2B prot...

details-Recombinant human ADORA2B protein with C-terminal human Fc tag
Polyclonal Antibody to JNK1/JNK2/JNK3 (phospho-Thr183/Tyr185)

Polyclonal Antibody to JNK1/JN...

details-Polyclonal Antibody to JNK1/JNK2/JNK3 (phospho-Thr183/Tyr185)
Recombinant human ITGB1 protein with C-terminal human Fc tag

Recombinant human ITGB1 protei...

details-Recombinant human ITGB1 protein with C-terminal human Fc tag
GFP/HeLa Stable Cell Line

GFP/HeLa Stable Cell Line

details-GFP/HeLa Stable Cell Line
Recombinant human GDNF protein with C-terminal human Fc tag

Recombinant human GDNF protein...

details-Recombinant human GDNF protein with C-terminal human Fc tag

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin

Related Products

Recombinant Human Bcl-xL (C-6His)

Recombinant Human Bcl-xL (C-6His)

Recombinant human C5AR1 protein with C-terminal human Fc tag

Recombinant human C5AR1 protein with C-terminal human Fc tag

Recombinant Human Hydroxyacid Oxidase 1/HAO1 (N-Trx, 6His)

Recombinant Human Hydroxyacid Oxidase 1/HAO1 (N-Trx, 6His)

New Products

Recombinant TLR2 Protein with human Fc Tag

Recombinant TLR2 Protein with human Fc Tag

Recombinant TLR9 Protein with human Fc Tag

Recombinant TLR9 Protein with human Fc Tag

Anti-IL-17A (Taltz) (Ixekizumab biosimilar) mAb

Anti-IL-17A (Taltz) (Ixekizumab biosimilar) mAb

close

Please Login to write a Review !!


close

Recombinant Human Xaa-Pro Aminopeptidase P3/XPNPEP3 (N, C-6His)

Product code: 32-8113
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart