Recombinant Human Zinc Finger Protein 762/ZFN762/ZIK1 (N-T7 tag)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris, pH 7.5. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MASMTGGQQMGRGSMAAAALRAPTQVTVSPETHMDLTKGCVTFEDIAIYFSQDEWGLLDEAQRLLYLEVMLENFALVASLGCGHGTEDEETPSDQNVSVGVSQSKAGSSTQKTQSCEMCVPVLKDILHLADLPGQKPYLVGECTNHHQHQKHHSAKKSLKRDMDRASYVKCCLFCMSLKPFRKWEVGKDLPAMLRLLRSLVFPGGKKPGTITECGEDIRSQKSHYKSGECGKASRHKHTPVYHPRVYTGKKLYECSKCGKAFRGKYSLVQHQRVHTGERPWECNECGKFFSQTSHLNDHRRIHTGERPYECSECGKLFRQNSSLVDHQKIHTGARPYECSQCGKSFSQKATLVKHQRVHTGERPYKCGECGNSFSQSAILNQHRRIHTGAKPYECGQC |
Source: E. coli.
MW :44.6kD.
Recombinant Human Zinc Finger Protein 762 is produced by our E.coli expression system and the target gene encoding Met1-Cys384 is expressed with a T7 tag at the N-terminus. Zinc Finger Protein Interacting with Ribonucleoprotein K (ZIK1) is a 487 amino acid nuclear protein that belongs to the Krueppel C2H2-Type Zinc-Finger Protein family. ZIK1 has nine C2H2-type zinc fingers and a KRAB domain. This protein is expressed at high levels in the gastric glands and at low levels in the colon and small intestine. It has been shown that ZIK1 is a transcriptional repressor that interacts with the Heterogeneous Nuclear Ribonucleoprotein Particle K Protein (HNRPK).
MW :44.6kD.
Recombinant Human Zinc Finger Protein 762 is produced by our E.coli expression system and the target gene encoding Met1-Cys384 is expressed with a T7 tag at the N-terminus. Zinc Finger Protein Interacting with Ribonucleoprotein K (ZIK1) is a 487 amino acid nuclear protein that belongs to the Krueppel C2H2-Type Zinc-Finger Protein family. ZIK1 has nine C2H2-type zinc fingers and a KRAB domain. This protein is expressed at high levels in the gastric glands and at low levels in the colon and small intestine. It has been shown that ZIK1 is a transcriptional repressor that interacts with the Heterogeneous Nuclear Ribonucleoprotein Particle K Protein (HNRPK).
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus |
| Tissue Specificity: | Expressed at high levels in gastric glands, and at low levels in colon and small intestine. Silenced through promoter methylation in gastric glands with intestinal metaplasia. |
| BioGrid: | 129823. 1 interactions. |
|
There are currently no product reviews
|



















.png)













