Recombinant Human Zymogen Granule Membrane Protein 16/ZG16 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | NAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRCVDHHHHHH |
Source: Human Cells.
MW :17.7kD.
Recombinant Human Zymogen Granule Membrane Protein 16 is produced by our Mammalian expression system and the target gene encoding Asn17-Cys167 is expressed with a 6His tag at the C-terminus. Zymogen Granule Membrane Protein 16 (ZG16) belongs to the jacalin lectin family. ZG16 is highly expressed in liver and is detected at lower levels in colon, ileum and jejunum. ZG16 may play a role in protein trafficking. In addition, ZG16 may act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.
MW :17.7kD.
Recombinant Human Zymogen Granule Membrane Protein 16 is produced by our Mammalian expression system and the target gene encoding Asn17-Cys167 is expressed with a 6His tag at the C-terminus. Zymogen Granule Membrane Protein 16 (ZG16) belongs to the jacalin lectin family. ZG16 is highly expressed in liver and is detected at lower levels in colon, ileum and jejunum. ZG16 may play a role in protein trafficking. In addition, ZG16 may act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted, Cytoplasmic vesicle lumen, Golgi apparatus lumen |
| Tissue Specificity: | Highly expressed in liver. Detected at lower levels in colon, ileum and jejunum. |
| BioGrid: | 576089. 4 interactions. |
|
There are currently no product reviews
|



















.png)










