Recombinant Human Ankyrin Repeat and SOCS Box Protein 13/ASB13 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Supplied as a 0.2 µm filtered solution of PBS, pH 7.4, 4M Urea. |
Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
AA sequence : | MNHKVHHHHHHMEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN |
Source: E. coli.
MW :31.4kD.
Recombinant Human ASB13 is produced by our E.coli expression system and the target gene encoding Met1-Asn278 is expressed with a 6His tag at the N-terminus. Ankyrin repeat and SOCS box protein 13(ASB13) is a member of the ankyrin repeat and SOCS box-containing (ASB) family. ASB13 contain six ankyrin repeats sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. ASB13 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
MW :31.4kD.
Recombinant Human ASB13 is produced by our E.coli expression system and the target gene encoding Met1-Asn278 is expressed with a 6His tag at the N-terminus. Ankyrin repeat and SOCS box protein 13(ASB13) is a member of the ankyrin repeat and SOCS box-containing (ASB) family. ASB13 contain six ankyrin repeats sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. ASB13 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
BioGrid: | 122865. 17 interactions. |
There are currently no product reviews
|