Recombinant Mouse Fc Receptor-like Protein 1/FCRL1/FcRH1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | AGISDVSLKTRPPGGWVMEGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIASELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPTENGISHLSHHHHHH |
Source: Human Cells.
MW :22.5kD.
Recombinant Mouse Fc receptor-like protein 1 is produced by our expression system and the target gene encoding Ala17-Ser219 is expressed with a 6His tag at the C-terminus. Mouse Fc receptor-like protein 1 (FCRL1) is a single-pass type I membrane protein. It is expressed in B-cells at the various stages of differentiation. Mouse FCRL1 consists of a 203 amino acid (aa) extracellular domain (ECD) with two Ig-like domains, a 21 aa transmembrane segment, and a 103 aa cytoplasmic domain with two immunotyrosine activation motifs (ITAMs). FCRL1 is likely not a receptor for immunoglobulin. It may function as an activating coreceptor in B-cells and B-cells differentiation.
MW :22.5kD.
Recombinant Mouse Fc receptor-like protein 1 is produced by our expression system and the target gene encoding Ala17-Ser219 is expressed with a 6His tag at the C-terminus. Mouse Fc receptor-like protein 1 (FCRL1) is a single-pass type I membrane protein. It is expressed in B-cells at the various stages of differentiation. Mouse FCRL1 consists of a 203 amino acid (aa) extracellular domain (ECD) with two Ig-like domains, a 21 aa transmembrane segment, and a 103 aa cytoplasmic domain with two immunotyrosine activation motifs (ITAMs). FCRL1 is likely not a receptor for immunoglobulin. It may function as an activating coreceptor in B-cells and B-cells differentiation.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | Phosphorylated on tyrosines upon activation. |
| Tissue Specificity: | Widely expressed. Expressed in B-cells at the various stages of differentiation. |
|
There are currently no product reviews
|




















.png)








