Recombinant Mouse Interleukin-18/IL-18/IL-1F4 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQSVDHHHHHH |
Source: Human Cells.
MW :19.2kD.
Recombinant Mouse Interleukin-18 is produced by our Mammalian expression system and the target gene encoding Asn36-Ser192 is expressed with a 6His tag at the C-terminus. Interleukin-18 (IL18, also known as interferon-gamma inducing factor) is a protein which in mouse is encoded by the IL18 gene, belongs to the IL-1 family. Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells
MW :19.2kD.
Recombinant Mouse Interleukin-18 is produced by our Mammalian expression system and the target gene encoding Asn36-Ser192 is expressed with a 6His tag at the C-terminus. Interleukin-18 (IL18, also known as interferon-gamma inducing factor) is a protein which in mouse is encoded by the IL18 gene, belongs to the IL-1 family. Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | The pro-IL-18 precursor is processed by CASP1 or CASP4 to yield the active form. |
|
There are currently no product reviews
|















.png)








