Recombinant Mouse V-Set and Ig Domain-Containing Protein 8/VSIG8 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of PBS, pH7.4, 10% Glycerol. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | VRINGDGQEVMYLAEGDNVRLGCPYLLDPEDLGTNSLDIEWMQVNSEPSHRENVFLTYQDKRIGHGNLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMSKGNDVVLKCFANGGSQPLSYKWAKISGHSHPYRAGAYHSQHSFHSELSYQESFHSTINQGLGNGDLLLKGINADDDGLYQCTVANHVGYSVCVVEVKVSDSQRVGHHHHHH |
Source: Human Cells.
MW :27.6kD.
Recombinant Mouse V-set and Immunoglobulin Domain-containing Protein 8 is produced by our Mammalian expression system and the target gene encoding Val22-Gly262 is expressed with a 6His tag at the C-terminus. V-set and immunoglobulin domain-containing protein 8(VSIG8) is a single-pass type I membrane protein.The mouse VSIG8 cDNA encodes 417 amino acids (aa) including a 21 aa signal sequence, a 241 aa extracellular domain (ECD) containing 2 Ig-like V-type (immunoglobulin-like) domains, a 21 aa transmembrane domain and a 134 aa cytoplasmic domain. The function of VSIG8 is not clear.
MW :27.6kD.
Recombinant Mouse V-set and Immunoglobulin Domain-containing Protein 8 is produced by our Mammalian expression system and the target gene encoding Val22-Gly262 is expressed with a 6His tag at the C-terminus. V-set and immunoglobulin domain-containing protein 8(VSIG8) is a single-pass type I membrane protein.The mouse VSIG8 cDNA encodes 417 amino acids (aa) including a 21 aa signal sequence, a 241 aa extracellular domain (ECD) containing 2 Ig-like V-type (immunoglobulin-like) domains, a 21 aa transmembrane domain and a 134 aa cytoplasmic domain. The function of VSIG8 is not clear.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
|
There are currently no product reviews
|











.png)












