Recombinant Mouse SLAM Family Member 7/CRACC/SLAM7/CD319 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SGTLKKVAGALDGSVTFTLNITEIKVDYVVWTFNTFFLAMVKKDGVTSQSSNKERIVFPDGLYSMKLSQLKKNDSGAYRAEIYSTSSQASLIQEYVLHVYKHLSRPKVTIDRQSNKNGTCVINLTCSTDQDGENVTYSWKAVGQGDNQFHDGATLSIAWRSGEKDQALTCMARNPVSNSFSTPVFPQKLCEDAATDLTSLRGHHHHHH |
Source: Human Cells.
MW :20.1kD.
Recombinant Mouse SLAM Family Member 7 is produced by our Mammalian expression system and the target gene encoding Ser23-Gly224 is expressed with a 6His tag at the C-terminus. SLAM family member 7/CRACC is a type I transmembrane glycoprotein in the SLAM subgroup of the CD2 family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Mature mouse CRACC consists of a 202 amino acid extracellular domain (ECD) with one Ig-like V-set domain and one Ig-like C2-set domain, a 21 aa transmembrane segment, and an 88 aa cytoplasmic domain with two immunoreceptor tyrosine-based switch motifs ITSMs. CRACC is expressed on the surface of NK cells, CD8+ T cells, activated B cells, and mature dendritic cells. It interacts homophilically to induce NK, CTL, and B cell activation.
MW :20.1kD.
Recombinant Mouse SLAM Family Member 7 is produced by our Mammalian expression system and the target gene encoding Ser23-Gly224 is expressed with a 6His tag at the C-terminus. SLAM family member 7/CRACC is a type I transmembrane glycoprotein in the SLAM subgroup of the CD2 family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Mature mouse CRACC consists of a 202 amino acid extracellular domain (ECD) with one Ig-like V-set domain and one Ig-like C2-set domain, a 21 aa transmembrane segment, and an 88 aa cytoplasmic domain with two immunoreceptor tyrosine-based switch motifs ITSMs. CRACC is expressed on the surface of NK cells, CD8+ T cells, activated B cells, and mature dendritic cells. It interacts homophilically to induce NK, CTL, and B cell activation.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Tissue Specificity: | Expressed in spleen, lymph node, bone marrow and testis. Lower levels detected in thymus. Expressed in NK cells, B-cells, natural killer cells and activated T-cells. |
|
There are currently no product reviews
|
















.png)










