Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
      • sdMAB ™
        • Shark sdMAB ™
        • Alpaca sdMAB ™
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
    • Custom Recombinant Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Porcine Trypsin

Recombinant Porcine Trypsin

Share:

Recombinant Porcine Trypsin

Roll over image to zoom in

   

Product code: 32-5142

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
2.5 mg
$363.00 

Bulk Order

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 2.5 mg
Purification : Recombinant Porcine Trypsin is expressed in E.coli and purified by standard chromatography techniques.
Content : The Porcine Trypsin was lyophilized with mannitol as preservative.
Storage condition : Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
AA sequence : VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN.
Trypsin (EC3.4.21.4) is part of the serine protease family. Trypsin cleaves lysine and arginine at the C-terminal side of the peptide. The hydrolysis rate is slower if an acidic residue is on either sides of the cleavage site and no cleavage occurs if a proline residue is on the carboxyl side of the cleavage site. Trypsin optimum pH is pH-7 to 9. Trypsin will also hydrolyze ester and amide linkages of synthetic derivatives of amino acids such as: benzoyl L-arginine ethyl ester (BAEE), p-toluenesulfonyl- L-arginine methyl ester (TAME), tosyl-L-arginine methyl ester, N-α-benzoyl-L-arginine p-nitroanilide (BAPNA), L-lysyl-p-nitroanilide, and benzoyl-L-tyrosine ethyl ester (BTEE). Serine protease inhibitors that inhibit recombinant trypsin include TLCK (N-p-tosyl-L-lysine chloromethyl ketone), PMSF (phenylmethanesulfonyl fluoride), benzamidine, soybean trypsin inhibitor, and ovomucoid.
 

Biological Activity: 4500 USP units/mg protein. One USP unit of trypsin activity will produce a Delta A253 of 0.003 per minute in a reaction volume of 3.0ml at pH7.6 and 25°C, with BAEE as a substrate (1cm light path).

Solubility: It is recommended to reconstitute the lyophilized Porcine Trypsin in sterile 1mM HCl or 50mM HAC not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
 

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-Rat TCR alpha/beta Low Endotoxin Antibody (Clone : R73)

Anti-Rat TCR alpha/beta Low En...

details-Anti-Rat TCR alpha/beta Low Endotoxin Antibody (Clone : R73)
Recombinant human CD39 protein with C-terminal human Fc tag

Recombinant human CD39 protein...

details-Recombinant human CD39 protein with C-terminal human Fc tag
Anti-GPRC5D antibody(DM62), Rabbit mAb

Anti-GPRC5D antibody(DM62), Ra...

details-Anti-GPRC5D antibody(DM62), Rabbit mAb
Recombinant human CD8A protein with C-terminal human Fc tag

Recombinant human CD8A protein...

details-Recombinant human CD8A protein with C-terminal human Fc tag
Anti-CD2 Monoclonal Antibody (Clone:IHC531)

Anti-CD2 Monoclonal Antibody (...

details-Anti-CD2 Monoclonal Antibody (Clone:IHC531)
Anti-Human CD268 FITC (Clone : 11C1)

Anti-Human CD268 FITC (Clone :...

details-Anti-Human CD268 FITC (Clone : 11C1)
anti-TNF-Alpha (mouse), mAb (blocking) (V1q) (preservative free)

anti-TNF-Alpha (mouse), mAb (b...

details-anti-TNF-Alpha (mouse), mAb (blocking) (V1q) (preservative free)
Recombinant Sars-Cov-2 (COVID-19/2019-nCov) Spike RBD Protein

Recombinant Sars-Cov-2 (COVID-...

details-Recombinant Sars-Cov-2 (COVID-19/2019-nCov) Spike RBD Protein
Monoclonal antibody to  PDL2 (Clone: ABM3D6.1G2)

Monoclonal antibody to PDL2 (...

details-Monoclonal antibody to  PDL2 (Clone: ABM3D6.1G2)
Anti-HSP60 Monoclonal Antibody (Clone : LK1) RPE

Anti-HSP60 Monoclonal Antibody...

details-Anti-HSP60 Monoclonal Antibody (Clone : LK1) RPE
Recombinant Human Peptidoglycan Recognition Protein 1

Recombinant Human Peptidoglyca...

details-Recombinant Human Peptidoglycan Recognition Protein 1
Anti-BCMA bispecific antibody(DM4)

Anti-BCMA bispecific antibody(...

details-Anti-BCMA bispecific antibody(DM4)
Anti-PSAP Monoclonal Antibody (Clone:IHC655)

Anti-PSAP Monoclonal Antibody ...

details-Anti-PSAP Monoclonal Antibody (Clone:IHC655)
Anti-Human CD8 PE (Clone : LT8)

Anti-Human CD8 PE (Clone : LT8...

details-Anti-Human CD8 PE (Clone : LT8)

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
ACE2/HEK293 Stable Cell Line

ACE2/HEK293 Stable Cell Line

details-ACE2/HEK293 Stable Cell Line
TLR4/IL-8 Leeporter™ Luciferase Reporter-HeLa Cell Line

TLR4/IL-8 Leeporter™ Luciferase R...

details-TLR4/IL-8 Leeporter™ Luciferase Reporter-HeLa Cell Line
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Related Products

Recombinant Human CD40 Ligand/CD40L/TNFSF5

Recombinant Human CD40 Ligand/CD40L/TNFSF5

FABP1  Recombinant Protein

FABP1 Recombinant Protein

Recombinant Human Activin Receptor 2B/Activin RIIB/ACVR2B (C-Fc-6His)

Recombinant Human Activin Receptor 2B/Activin RIIB/ACVR2B (C-Fc-6His)

New Products

Recombinant Human LY6H Protein, hFc Tag

Recombinant Human LY6H Protein, hFc Tag

Recombinant Human CD19 Protein, mFc Tag

Recombinant Human CD19 Protein, mFc Tag

Recombinant Human CHODL Protein, hFc Tag

Recombinant Human CHODL Protein, hFc Tag

close

Please Login to write a Review !!


close

Recombinant Porcine Trypsin

Product code: 32-5142
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™
  • sdMAB ™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development
  • Custom Recombinant Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart