Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Porcine Trypsin

Recombinant Porcine Trypsin

Share:

Recombinant Porcine Trypsin

Roll over image to zoom in

   

Product code: 32-5142

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
2.5 mg
$363.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 2.5 mg
Purification : Recombinant Porcine Trypsin is expressed in E.coli and purified by standard chromatography techniques.
Content : The Porcine Trypsin was lyophilized with mannitol as preservative.
Storage condition : Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
AA sequence : VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN.
Trypsin (EC3.4.21.4) is part of the serine protease family. Trypsin cleaves lysine and arginine at the C-terminal side of the peptide. The hydrolysis rate is slower if an acidic residue is on either sides of the cleavage site and no cleavage occurs if a proline residue is on the carboxyl side of the cleavage site. Trypsin optimum pH is pH-7 to 9. Trypsin will also hydrolyze ester and amide linkages of synthetic derivatives of amino acids such as: benzoyl L-arginine ethyl ester (BAEE), p-toluenesulfonyl- L-arginine methyl ester (TAME), tosyl-L-arginine methyl ester, N-α-benzoyl-L-arginine p-nitroanilide (BAPNA), L-lysyl-p-nitroanilide, and benzoyl-L-tyrosine ethyl ester (BTEE). Serine protease inhibitors that inhibit recombinant trypsin include TLCK (N-p-tosyl-L-lysine chloromethyl ketone), PMSF (phenylmethanesulfonyl fluoride), benzamidine, soybean trypsin inhibitor, and ovomucoid.
 

Biological Activity: 4500 USP units/mg protein. One USP unit of trypsin activity will produce a Delta A253 of 0.003 per minute in a reaction volume of 3.0ml at pH7.6 and 25°C, with BAEE as a substrate (1cm light path).

Solubility: It is recommended to reconstitute the lyophilized Porcine Trypsin in sterile 1mM HCl or 50mM HAC not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
 

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-Actin, Smooth Muscle Monoclonal Antibody (Clone:IHC506)

Anti-Actin, Smooth Muscle Mono...

details-Anti-Actin, Smooth Muscle Monoclonal Antibody (Clone:IHC506)
Celltase™ Cell Detachment Solution

Celltase™ Cell Detachment So...

details-Celltase™ Cell Detachment Solution
Anti-PSA Monoclonal Antibody (Clone:IHC654)-Ready to Use

Anti-PSA Monoclonal Antibody (...

details-Anti-PSA Monoclonal Antibody (Clone:IHC654)-Ready to Use
Apo Transferrin Native Protein

Apo Transferrin Native Protein

details-Apo Transferrin Native Protein
Anti-Mouse CD106 PE (Clone : 429 (MVCAM.A))

Anti-Mouse CD106 PE (Clone : 4...

details-Anti-Mouse CD106 PE (Clone : 429 (MVCAM.A))
Anti-Human SUSD2 Antibody (Clone : W5C5)

Anti-Human SUSD2 Antibody (Clo...

details-Anti-Human SUSD2 Antibody (Clone : W5C5)
Anti-GPRC5D antibody(DM62), Rabbit mAb

Anti-GPRC5D antibody(DM62), Ra...

details-Anti-GPRC5D antibody(DM62), Rabbit mAb
Anti-CD2 Monoclonal Antibody (Clone:IHC531)

Anti-CD2 Monoclonal Antibody (...

details-Anti-CD2 Monoclonal Antibody (Clone:IHC531)
Anti-Human CD268 FITC (Clone : 11C1)

Anti-Human CD268 FITC (Clone :...

details-Anti-Human CD268 FITC (Clone : 11C1)
anti-TNF-Alpha (mouse), mAb (blocking) (V1q) (preservative free)

anti-TNF-Alpha (mouse), mAb (b...

details-anti-TNF-Alpha (mouse), mAb (blocking) (V1q) (preservative free)
Recombinant Human Cadherin-9/CDH9 (C-6His)(Discontinued)

Recombinant Human Cadherin-9/C...

details-Recombinant Human Cadherin-9/CDH9 (C-6His)(Discontinued)
mFGF-15 Recombinant Protein

mFGF-15 Recombinant Protein

details-mFGF-15 Recombinant Protein
Low Endotoxin Anti-Transferrin Monoclonal Antibody (Clone:HTF-14)

Low Endotoxin Anti-Transferrin...

details-Low Endotoxin Anti-Transferrin Monoclonal Antibody (Clone:HTF-14)
Anti-PSAP Monoclonal Antibody (Clone:IHC655)

Anti-PSAP Monoclonal Antibody ...

details-Anti-PSAP Monoclonal Antibody (Clone:IHC655)

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Related Products

Recombinant human CEACAM8 protein with C-terminal human Fc tag

Recombinant human CEACAM8 protein with C-terminal human Fc tag

Activin A Plant Recombinant Protein

Activin A Plant Recombinant Protein

NUDT2 Recombinant Protein

NUDT2 Recombinant Protein

New Products

Anti-Human CD156c MAb (Clone :11G2)

Anti-Human CD156c MAb (Clone :11G2)

Anti-Human CD85g APC MAb(Clone :17G10.2)

Anti-Human CD85g APC MAb(Clone :17G10.2)

Anti-Human CD158z PE MAb(Clone :CH21)

Anti-Human CD158z PE MAb(Clone :CH21)

close

Please Login to write a Review !!


close

Recombinant Porcine Trypsin

Product code: 32-5142
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart