Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Recombinant Proteins
    4. /
    5. Recombinant Porcine Trypsin

    Recombinant Porcine Trypsin

    Share:

    Recombinant Porcine Trypsin

    Roll over image to zoom in

       

    Product code: 32-5142

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price
    2.5 mg
    $325.00  $260.00 

    Add to Wish List

    Bulk Order

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual

    • Product Info
    • Description
    • Application Note
    • Review   (0)
    Amount : 2.5 mg
    Purification : Recombinant Porcine Trypsin is expressed in E.coli and purified by standard chromatography techniques.
    Content : The Porcine Trypsin was lyophilized with mannitol as preservative.
    Storage condition : Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
    AA sequence : VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN.
    Trypsin (EC3.4.21.4) is part of the serine protease family. Trypsin cleaves lysine and arginine at the C-terminal side of the peptide. The hydrolysis rate is slower if an acidic residue is on either sides of the cleavage site and no cleavage occurs if a proline residue is on the carboxyl side of the cleavage site. Trypsin optimum pH is pH-7 to 9. Trypsin will also hydrolyze ester and amide linkages of synthetic derivatives of amino acids such as: benzoyl L-arginine ethyl ester (BAEE), p-toluenesulfonyl- L-arginine methyl ester (TAME), tosyl-L-arginine methyl ester, N-α-benzoyl-L-arginine p-nitroanilide (BAPNA), L-lysyl-p-nitroanilide, and benzoyl-L-tyrosine ethyl ester (BTEE). Serine protease inhibitors that inhibit recombinant trypsin include TLCK (N-p-tosyl-L-lysine chloromethyl ketone), PMSF (phenylmethanesulfonyl fluoride), benzamidine, soybean trypsin inhibitor, and ovomucoid.
     

    Biological Activity: 4500 USP units/mg protein. One USP unit of trypsin activity will produce a Delta A253 of 0.003 per minute in a reaction volume of 3.0ml at pH7.6 and 25°C, with BAEE as a substrate (1cm light path).

    Solubility: It is recommended to reconstitute the lyophilized Porcine Trypsin in sterile 1mM HCl or 50mM HAC not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
     

    For Research Use Only. Not for use in diagnostic/therapeutics procedures.

    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    CRP Native Protein

    CRP Native Protein

    details-CRP Native Protein
    Mouse Monoclonal Antibody to Human KRT20 (Clone : 13F8)(Discontinued)

    Mouse Monoclonal Antibody to H...

    details-Mouse Monoclonal Antibody to Human KRT20 (Clone : 13F8)(Discontinued)
    Anti-Human CD100 Antibody (Clone : 133-1C6)

    Anti-Human CD100 Antibody (Clo...

    details-Anti-Human CD100 Antibody (Clone : 133-1C6)
    Anti-HDAC6 Antibody (Clone : 2H3)

    Anti-HDAC6 Antibody (Clone : 2...

    details-Anti-HDAC6 Antibody (Clone : 2H3)
    Apo Transferrin Native Protein

    Apo Transferrin Native Protein

    details-Apo Transferrin Native Protein
    Anti-Human SUSD2 Antibody (Clone : W5C5)

    Anti-Human SUSD2 Antibody (Clo...

    details-Anti-Human SUSD2 Antibody (Clone : W5C5)
    Anti-Her2/Neu Monoclonal Antibody (Clone:IHC042)-Ready to Use

    Anti-Her2/Neu Monoclonal Antib...

    details-Anti-Her2/Neu Monoclonal Antibody (Clone:IHC042)-Ready to Use
    Anti-Cytokeratin (Pan-reactive) Monoclonal Antibody (Clone:C-11)

    Anti-Cytokeratin (Pan-reactive...

    details-Anti-Cytokeratin (Pan-reactive) Monoclonal Antibody (Clone:C-11)
    Anti-CD2 Monoclonal Antibody (Clone:IHC531)

    Anti-CD2 Monoclonal Antibody (...

    details-Anti-CD2 Monoclonal Antibody (Clone:IHC531)
    Anti-SARS-CoV-2 Nucleocapsid antibody(DM37), Rabbit mAb

    Anti-SARS-CoV-2 Nucleocapsid a...

    details-Anti-SARS-CoV-2 Nucleocapsid antibody(DM37), Rabbit mAb
    Anti-HSP60 Monoclonal Antibody (Clone : LK1) HRP

    Anti-HSP60 Monoclonal Antibody...

    details-Anti-HSP60 Monoclonal Antibody (Clone : LK1) HRP
    Low Endotoxin Anti-Transferrin Monoclonal Antibody (Clone:HTF-14)

    Low Endotoxin Anti-Transferrin...

    details-Low Endotoxin Anti-Transferrin Monoclonal Antibody (Clone:HTF-14)
    Anti-HSP60 Monoclonal Antibody (Clone : LK1) RPE

    Anti-HSP60 Monoclonal Antibody...

    details-Anti-HSP60 Monoclonal Antibody (Clone : LK1) RPE
    Recombinant Human Peptidoglycan Recognition Protein 1

    Recombinant Human Peptidoglyca...

    details-Recombinant Human Peptidoglycan Recognition Protein 1

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    Recombinant Human Transferrin

    Recombinant Human Transferrin

    Recombinant Hepatitis C Virus NS3 Genotype-6a(1192-1459)

    Recombinant Hepatitis C Virus NS3 Genotype-6a(1192-1459)

    Recombinant Human Regulation Of Nuclear Pre-MRNA Domain Containing 1A

    Recombinant Human Regulation Of Nuclear Pre-MRNA Domain Containing 1A

    close

    Please Login to write a Review !!


    close

    Recombinant Porcine Trypsin

    Product code: 32-5142
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart