Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Cell Lines
    4. /
    5. Stable Cell Lines
    6. /
    7. ACE2/CHO-K1 Stable Cell Line

    ACE2/CHO-K1 Stable Cell Line

    Share:

    Fig-1: Detection of human ACE2 in the ACE2/CHO-K1 stable cell line by Flow Cytometry [Cell surface staining] using anti-human ACE2 antibody (Clone AC18F; Abeomics Cat. No.: 10-10031-AT488). Parental CHO-K1 cells (Green); ACE2/CHO-K1 cells (Red).

    ACE2/CHO-K1 Stable Cell Line
    ACE2/CHO-K1 Stable Cell Line
    ACE2/CHO-K1 Stable Cell Line
    ACE2/CHO-K1 Stable Cell Line

    Roll over image to zoom in

       
    Fig-1: Detection of human ACE2 in the ACE2/CHO-K1 stable cell line by Flow Cytometry [Cell surface staining] using anti-human ACE2 antibody (Clone AC18F; Abeomics Cat. No.: 10-10031-AT488). Parental CHO-K1 cells (Green); ACE2/CHO-K1 cells (Red).
    Fig-2: Binding of biotinylated SARS-Cov-2 Spike RBD protein to human ACE2 in the ACE2/CHO-K1 stable cell line. ACE2/CHO-K1 cells were probed with different amounts of biotinylated SARS-Cov-2 Spike RBD protein (Abeomics, Cat. No. 21-1005-B) and analyzed by flow cytometry through fluorescent-labeled Streptavidin detection.
    Fig-3: Binding of biotinylated SARS-Cov-2 Spike RBD protein to human ACE2 in the ACE2/CHO-K1 stable cell line. ACE2/CHO-K1 cells were incubated with various concentrations of biotinylated SARS-Cov-2 Spike RBD protein (Abeomics, Cat. No. 21-1005-B) and analyzed through In-Cell ELISA. RBD binds to ACE2/CHO-K1 with an EC50 of 1.33 µg/ml.
    Fig-4: Neutralization of binding between ACE2/CHO-K1 cells and SARS-Cov-2 Spike RBD protein by the Recombinant Anti-SARS-CoV-2 Spike RBD antibodies (CR3022: Abeomics, Cat. No. 10-2004 and ABMX-002: Abeomics, Cat. No. 10-2005). CHO-K1/ACE2 stable cells were incubated with various concentrations of RBD antibodies in the presence of biotinylated SARS-Cov-2 Spike RBD protein (Abeomics, Cat. No. 21-1005-B) and analyzed through In-Cell ELISA using HRP-Streptavidin for detection.

    Product code: 14-523ACL

    Application : Functional Assay

    Shipping Info:

    Order now and get it on Tuesday June 28, 2022

    Same day delivery FREE on San Diego area orders placed by 1.00 PM

    Local delivery areas

    Same-day delivery in San Diego available for the following zip codes:

    92121, 92122, 92037, 92117, 92109, 92110, 92101, 92010, 92011, 92009, 92008
    Download TDS / Manual MSDS
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price
    1 vial
    $2,750.00  $2,062.50 

    Add to Wish List

    Bulk Order

    Shipping Info:

    Order now and get it on Tuesday June 28, 2022

    Same day delivery FREE on San Diego area orders placed by 1.00 PM

    Download TDS / Manual MSDS

    • Product Info
    • Description
    • Application Note
    • Review   (0)
    Amount : 1 vial
    Content : Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO
    Storage condition : Immediately upon receipt, store in liquid nitrogen.

    ACE2/CHO-K1 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human angiotensin-converting enzyme 2 (ACE2). ACE2 is a type I transmembrane metalloenzyme located on the outer surface of endothelial cells in the lung, arteries, heart, kidney and intestines. ACE2 cleaves the carboxyl-terminal amino acid phenylalanine from angiotensin II and hydrolyses it into the vasodilator angiotensin. ACE2 also serves as an entry receptor for some coronaviruses including HCoV-NL63, SARS-CoV and SARS-CoV-2 as the virus that causes COVID-19.

    Sequence data: hACE2 (accession number NP_068576)

    MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSS
    LASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
    NGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNE
    RLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYS
    RGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWT
    NLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLT
    DPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLL
    RNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTL
    PFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSN
    DYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPW
    TLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISL
    KSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFN
    FFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVS
    IWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYASIDISKGENNPGFQNT
    DDVQTSF
     

     

    Application:.

    •  Screen for antibodies of human ACE2 through Flow Cytometry. 
    •  Screen for neutralizing antibodies.
    •  Protein binding study.

    Culture conditions:

    Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1% Pen/Strep, plus 500 µg/ml of Hygromycin.
     
    It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Hygromycin, spin down cells, resuspend cells in pre-warmed growth medium without Hygromycin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator.
     
    Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Hygromycin. Cells should be split before they reach complete confluence.
     
    To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
     
     
     

    LIMITED USE RESTRICTIONS:

    THIS PRODUCT IS SOLELY FOR IN VITRO RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE.

    By use of this product, user agrees to be bound by the terms of this limited use statement.

    This product is solely for Internal Research Purposes and not for Commercial Purposes. Commercial Purposes include, but are not limited to (1) use of the cell line in manufacturing; (2) use of the cell line to provide a service, information or data; (3) use of the cell line for therapeutic, diagnostic or prophylactic purposes; or (4) resale of the cell line whether or not such cell lines are resold for use in research. The buyer cannot sell, give or otherwise transfer this product to a third party.

    Commercial License Agreement is available for non-research use if applicable. Please contact Abeomics (info@abeomics.com).

     

     

    For Research Use Only. Not for use in diagnostic/therapeutics procedures.

    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    2019-nCoV Nucleocapsid Protein

    2019-nCoV Nucleocapsid Protein

    details-2019-nCoV Nucleocapsid Protein
    Cyclophilin C Recombinant Protein

    Cyclophilin C Recombinant Prot...

    details-Cyclophilin C Recombinant Protein
    FABP4 Native Protein

    FABP4 Native Protein

    details-FABP4 Native Protein
    TNF-beta Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    TNF-beta Leeporter™ Lucifera...

    details-TNF-beta Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Anti-Human IL-2R alpha (CD25) (Basiliximab) – PE

    Anti-Human IL-2R alpha (CD25) ...

    details-Anti-Human IL-2R alpha (CD25) (Basiliximab) – PE
    CpG ODN (1826), TLR9 ligand (Class B)

    CpG ODN (1826), TLR9 ligand (C...

    details-CpG ODN (1826), TLR9 ligand (Class B)
    Recombinant Sars-Cov-2 (COVID-19/2019-nCov) S1+S2 ECD Protein

    Recombinant Sars-Cov-2 (COVID-...

    details-Recombinant Sars-Cov-2 (COVID-19/2019-nCov) S1+S2 ECD Protein
    Rabbit Polyclonal Antibody to H1N1 NS1(Discontinued)

    Rabbit Polyclonal Antibody to ...

    details-Rabbit Polyclonal Antibody to H1N1 NS1(Discontinued)
    Anti-CD22 Monoclonal Antibody (Clone:S-HCL-1)-APC Conjugated(Discontinued)

    Anti-CD22 Monoclonal Antibody ...

    details-Anti-CD22 Monoclonal Antibody (Clone:S-HCL-1)-APC Conjugated(Discontinued)
    Recombinant human TYRO3 protein with C-terminal human Fc tag

    Recombinant human TYRO3 protei...

    details-Recombinant human TYRO3 protein with C-terminal human Fc tag
    Anti-HSP90 Monoclonal Antibody (Clone: AC-16)(Discontinued)

    Anti-HSP90 Monoclonal Antibody...

    details-Anti-HSP90 Monoclonal Antibody (Clone: AC-16)(Discontinued)
    Anti-Human CD318 Antibody (Clone : CUB1)

    Anti-Human CD318 Antibody (Clo...

    details-Anti-Human CD318 Antibody (Clone : CUB1)
    Protein A Monoclonal Antibody (Clone: ABM4B3.1G3)

    Protein A Monoclonal Antibody ...

    details-Protein A Monoclonal Antibody (Clone: ABM4B3.1G3)
    Recombinant Human ACE2 Protein with His and Avi tag

    Recombinant Human ACE2 Protein...

    details-Recombinant Human ACE2 Protein with His and Avi tag

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    D1 Stable Cell Line-CHO-K1-Human(Currently Unavailable)

    D1 Stable Cell Line-CHO-K1-Human(Currently Unavailable)

    G alpha 15 Stable Cell Line-CCR5-CHO-K1-Human(Currently Unavailable)

    G alpha 15 Stable Cell Line-CCR5-CHO-K1-Human(Currently Unavailable)

    BDCA2 Stable Cell Line-CHO-K1-Cynomolgus(Currently Unavailable)

    BDCA2 Stable Cell Line-CHO-K1-Cynomolgus(Currently Unavailable)

    New Products

    Recombinant Human Ephrin A Receptor 4/EphA4 (C-6His)

    Recombinant Human Ephrin A Receptor 4/EphA4 (C-6His)

    close

    Please Login to write a Review !!


    close

    ACE2/CHO-K1 Stable Cell Line

    Product code: 14-523ACL
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart