ACE2 Recombinant protein

Product code: 21-1011

Shipping Info:

Order now and get it on Tuesday April 07, 2026

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
50 μg
$350.00 

Add to Wish List

Shipping Info:

Order now and get it on Tuesday April 07, 2026

Same day delivery FREE on San Diego area orders placed by 1.00 PM


Amount : 50 μg
Purification : >95% by SDS-PAGE.
Content : 0.5 mg/ml in 50 mM Tris, pH-7.4, 300 mM NaCl and 10% Glycerol
Storage condition : ACE2 Protein is shipped on ice packs. Upon arrival, Store at -20°C. Do not freeze-thaw multiple times.
AA sequence : MDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRLEHHHHHH
Gene : ACE2
Gene ID : 59272
Uniprot ID : Q9BYF1
Alternative Name : Angiotensin-converting enzyme homolog, Angiotensin-converting enzyme-related carboxypeptidase, Metalloprotease MPROT15
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products