Human PD-L1 Recombinant Fc fusion Protein (Active) Biotin conjugated

Product code: 21-1001-B

Application : Functional Assay

Shipping Info:

Order now and get it on Tuesday April 07, 2026

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
100 µg
$409.00 

Add to Wish List

Shipping Info:

Order now and get it on Tuesday April 07, 2026

Same day delivery FREE on San Diego area orders placed by 1.00 PM


Amount : 100 µg
Purification : 99% Purity SDS -PAGE and HPLC.
Content : Lyophilized sterile PBS, 5% trehalose and 0.01% tween 80 are added as protectant before lyophilization.
Storage condition : Store it under sterile conditions at -4°C. It is recommended that the protein be aliquoted for optimal storage.
AA sequence : Human PD-L1 (ECD): MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPV EKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLL KDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA PYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLS GKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENH TAELVIPELPLAHPPNER
Alternative Name : B7 homolog 1, CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1

Host: CHO-K1 celline. PD-L1 (CD274/B7-H1) is a critical membrane-bound costimulatory molecule belongs to the B7 superfamily that inhibits immune responses through its receptor, PD-1 and PD-L1 play a key role in the pathogenesis of inflammatory diseases (programmed death 1). It is widely expressed in the mononuclear phagocyte system (MPS), may co-stimulate T cells and regulates inflammatory responses. PD-L1 exerts inflammation regulatory functions via a negative co-stimulatory effect on T cell functions to inhibit cytokine secretion, facilitate apoptosis of activated T cells and induce T cell anergy. Aberrant expression and dysregulation of CD274 have been reported during bacterial infection, inflammation and in numerous autoimmune diseases. 

Functional assay: Measured by its binding ability in a functional FLOW . Binding assay was tested using CHO-K1/PD-1  (cat no. 14-500ACL). 

Endotoxin: < 1.0 EU per μg of the protein as determined by the LAL method

 

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products