Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein/OASLOASL (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLDAVRTVEEFLRQEHFQGKRGLDQDVRVLKVVKVGSFGNGTVLRSTREVELVAFLSCFHSFQEAAKHLEHHHHHH |
Source: E. coli.
MW :12.6kD.
Recombinant Human OASL is produced by our E.coli expression system and the target gene encoding Met1-His100 is expressed with a 6His tag at the C-terminus. 2'-5'-oligoadenylate synthase-like protein (OASL) contains 2 ubiquitin-like domains, and belongs to the 2-5A synthase family. The ubiquitin-like domains are essential for its antiviral activity. OASL can be induced by type I interferon (IFN) and viruses, and expressed in most tissues such as primary blood Leukocytes and other hematopoietic system tissues, colon, stomach and to some extent in testis. OASL can specifically interacts with the ligand binding domain of the thyroid receptor (TR) without the presence of thyroid hormone. It does not have 2'-5'-OAS activity, but can bind double-stranded RNA. It also displays antiviral activity against encephalomyocarditis virus (EMCV) and hepatitis C virus (HCV) via an alternative antiviral pathway independent of RNase L.
MW :12.6kD.
Recombinant Human OASL is produced by our E.coli expression system and the target gene encoding Met1-His100 is expressed with a 6His tag at the C-terminus. 2'-5'-oligoadenylate synthase-like protein (OASL) contains 2 ubiquitin-like domains, and belongs to the 2-5A synthase family. The ubiquitin-like domains are essential for its antiviral activity. OASL can be induced by type I interferon (IFN) and viruses, and expressed in most tissues such as primary blood Leukocytes and other hematopoietic system tissues, colon, stomach and to some extent in testis. OASL can specifically interacts with the ligand binding domain of the thyroid receptor (TR) without the presence of thyroid hormone. It does not have 2'-5'-OAS activity, but can bind double-stranded RNA. It also displays antiviral activity against encephalomyocarditis virus (EMCV) and hepatitis C virus (HCV) via an alternative antiviral pathway independent of RNase L.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|












.png)











