Recombinant Human C-C Motif Chemokine 28/CCL28(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MSEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
Source: E.coli.
MW :12.49kD.
Recombinant Human C-C Motif Chemokine 28 is produced by our E.coli expression system and the target gene encoding Ile20-Tyr127 is expressed. Chemokine (C-C Motif) Ligand 28 (CCL28) is a novel chemokine that shares the most homology with CCL27/CTACK. CCL28 shows chemotactic activity for resting CD4, CD8 T-cells and eosinophils. It Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner. CCR10 (GPR2 orphan receptor) is also the receptor for CCL27/CTACK. CCL28 is preferentially expressed by epithelial cells of diverse tissues, with highest expression level in normal and pathological colon. It is also expressed in normal and asthmatic lung tissues. Human and mouse CCL28 shares 83% sequence identity in their mature regions.
MW :12.49kD.
Recombinant Human C-C Motif Chemokine 28 is produced by our E.coli expression system and the target gene encoding Ile20-Tyr127 is expressed. Chemokine (C-C Motif) Ligand 28 (CCL28) is a novel chemokine that shares the most homology with CCL27/CTACK. CCL28 shows chemotactic activity for resting CD4, CD8 T-cells and eosinophils. It Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner. CCR10 (GPR2 orphan receptor) is also the receptor for CCL27/CTACK. CCL28 is preferentially expressed by epithelial cells of diverse tissues, with highest expression level in normal and pathological colon. It is also expressed in normal and asthmatic lung tissues. Human and mouse CCL28 shares 83% sequence identity in their mature regions.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Preferentially expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. Also found in prostate, spleen, thyroid, psoriasis skin and in lower levels in peripheral blood leukocytes, small intestine, Peyer patches, stomach and normal skin. |
| BioGrid: | 121147. 3 interactions. |
|
There are currently no product reviews
|



















.png)










