Recombinant Human Protein Phosphatase 1C Catalytic Subunit/PPP1CC (N, C-6His)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0 . |
Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
AA sequence : | MGSSHHHHHHSSGLVPRGSHMADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKKLEHHHHHH |
Source: E.coli.
MW :40.2kD.
Recombinant Human PPP1CC is produced by our E.coli expression system and the target gene encoding Met1-Lys323 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. Serine/Threonine-Protein Phosphatase PP1-? Catalytic Subunit (PPP1CC) is a member of the PPP phosphatase family. It is essential for cell division, participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. PPP1CC colocalizes with SPZ1 in the nucleus, with URI1 at mitochondrion, Rapidly exchanges between the nucleolar, nucleoplasmic and cytoplasmic compartments. As a cofactor, PPP1CC binds one iron ion and one manganese ion per subunit.. In addition, PPP1CC may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II.
MW :40.2kD.
Recombinant Human PPP1CC is produced by our E.coli expression system and the target gene encoding Met1-Lys323 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. Serine/Threonine-Protein Phosphatase PP1-? Catalytic Subunit (PPP1CC) is a member of the PPP phosphatase family. It is essential for cell division, participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. PPP1CC colocalizes with SPZ1 in the nucleus, with URI1 at mitochondrion, Rapidly exchanges between the nucleolar, nucleoplasmic and cytoplasmic compartments. As a cofactor, PPP1CC binds one iron ion and one manganese ion per subunit.. In addition, PPP1CC may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Cytoplasm, Nucleus, Nucleus, Nucleus, Nucleus speckle, Chromosome, Cleavage furrow, Midbody, Mitochondrion |
Post transnational modification: | Phosphorylated by NEK2. |
BioGrid: | 111495. 304 interactions. |
There are currently no product reviews
|