Recombinant Human CD3 e/CD3E (C-Fc)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :38.7kD.
Recombinant Human CD3 epsilon is produced by our Mammalian expression system and the target gene encoding Asp23-Asp126 is expressed with a Fc tag at the C-terminus. T-Cell Surface Glycoprotein CD3 e Chain (CD3e) is a single-pass type I membrane protein. CD3e contains 1 Ig-like (immunoglobulin-like) domain and 1 ITAM domain. CD3e is a polypeptide encoded by the CD3E gene on chromosome 11 in humans. The T cell receptor-CD3 complex (TCR/CD3 complex) is involved in T-cell development and several intracellular signal-transduction pathways. This complex is critical for T-cell development and function, and represents one of the most complex transmembrane receptors. The T cell receptor-CD3 complex is unique in having ten cytoplasmic immunoreceptor tyrosine-based activation motifs (ITAMs). TCR/CD3 complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways.
MW :38.7kD.
Recombinant Human CD3 epsilon is produced by our Mammalian expression system and the target gene encoding Asp23-Asp126 is expressed with a Fc tag at the C-terminus. T-Cell Surface Glycoprotein CD3 e Chain (CD3e) is a single-pass type I membrane protein. CD3e contains 1 Ig-like (immunoglobulin-like) domain and 1 ITAM domain. CD3e is a polypeptide encoded by the CD3E gene on chromosome 11 in humans. The T cell receptor-CD3 complex (TCR/CD3 complex) is involved in T-cell development and several intracellular signal-transduction pathways. This complex is critical for T-cell development and function, and represents one of the most complex transmembrane receptors. The T cell receptor-CD3 complex is unique in having ten cytoplasmic immunoreceptor tyrosine-based activation motifs (ITAMs). TCR/CD3 complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | Phosphorylated on Tyr residues after T-cell receptor triggering by LCK in association with CD4/CD8. |
| BioGrid: | 107354. 25 interactions. |
|
There are currently no product reviews
|












.png)










