Recombinant Human Cell Adhesion Molecule 3/CADM3/IGSF4B/SynCAM3 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYHVDHHHHHH |
Source: Human Cells.
MW :34.68kD.
Recombinant Human Cell Adhesion Molecule 3 is produced by our Mammalian expression system and the target gene encoding Asn25-His330 is expressed with a 6His tag at the C-terminus. Cell Adhesion Molecular Proteins are proteins located on the cell surface involved with the binding with other cells or with the extracellular matrix in the cell adhesion process. These proteins consists of three domains, an transmembrane domain, an intracellular domain that interacts with the cytoskeleton, and an extracellular domain that interacts with other CAMs of the same kind or with other CAMs or the extracellular matrix. Cell Adhesion Molecular 3 (CADM3) is a neural tissue-specific member of the nectin-like family of immunoglobulin superfamily. CADM3 interacts with EPB41L1 may regulate structure or function of cell-cell junctions. CADM3 has both calcium-independent homophilic cell-cell adhesion activity and calcium-independent heterophilic cell-cell adhesion activity with IGSF4, PVRL1 and PVRL3.
MW :34.68kD.
Recombinant Human Cell Adhesion Molecule 3 is produced by our Mammalian expression system and the target gene encoding Asn25-His330 is expressed with a 6His tag at the C-terminus. Cell Adhesion Molecular Proteins are proteins located on the cell surface involved with the binding with other cells or with the extracellular matrix in the cell adhesion process. These proteins consists of three domains, an transmembrane domain, an intracellular domain that interacts with the cytoskeleton, and an extracellular domain that interacts with other CAMs of the same kind or with other CAMs or the extracellular matrix. Cell Adhesion Molecular 3 (CADM3) is a neural tissue-specific member of the nectin-like family of immunoglobulin superfamily. CADM3 interacts with EPB41L1 may regulate structure or function of cell-cell junctions. CADM3 has both calcium-independent homophilic cell-cell adhesion activity and calcium-independent heterophilic cell-cell adhesion activity with IGSF4, PVRL1 and PVRL3.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane, Cell junction |
| Tissue Specificity: | Isoform 1 is expressed mainly in adult and fetal brain. Isoform 2 is highly expressed in adult brain and weakly expressed in placenta. In brain, Isoform 2 is highly expressed in cerebellum. |
|
There are currently no product reviews
|













.png)









