Recombinant Human Chloride Intracellular Channel Protein 1/CLIC1 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK |
Source: E. coli.
MW :29kD.
Recombinant Human CLIC1 is produced by our E.coli expression system and the target gene encoding Met1-Lys241 is expressed with a 6His tag at the N-terminus. Chloride Intracellular Channel Protein 1 (CLIC1) belongs to the Chloride Channel CLIC family and contains one GST C-terminal domain. CLIC1 can be expressed in various cell types, but it is especially prominent in the heart, placenta, liver, kidney, and pancreas. CLIC1 can insert into membranes and form chloride ion channels. The channel activity depends on the pH. CLIC1 membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. CLIC1 is also involved in the regulation of the cell cycle.
MW :29kD.
Recombinant Human CLIC1 is produced by our E.coli expression system and the target gene encoding Met1-Lys241 is expressed with a 6His tag at the N-terminus. Chloride Intracellular Channel Protein 1 (CLIC1) belongs to the Chloride Channel CLIC family and contains one GST C-terminal domain. CLIC1 can be expressed in various cell types, but it is especially prominent in the heart, placenta, liver, kidney, and pancreas. CLIC1 can insert into membranes and form chloride ion channels. The channel activity depends on the pH. CLIC1 membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. CLIC1 is also involved in the regulation of the cell cycle.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Nucleus membrane, Cytoplasm, Cell membrane |
| Post transnational modification: | Hydrogen peroxide treatment causes a conformation change, leading to dimerization and formation of an intramolecular disulfide bond between Cys-24 and Cys-59. |
| Tissue Specificity: | Expression is prominent in heart, placenta, liver, kidney and pancreas. |
| BioGrid: | 107604. 58 interactions. |
|
There are currently no product reviews
|
















.png)






