Recombinant Human Pancreatic Lipase-Related Protein 2/PLRP2 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,1mM GaCl2,10%Glycerol,pH7.5. |
Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
AA sequence : | KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPCLDHHHHHH |
Source: Human Cells.
MW :51.16kD.
Recombinant Human Pancreatic Lipase-Related Protein 2 is produced by our Mammalian expression system and the target gene encoding Lys18-Cys469 is expressed with a 6His tag at the C-terminus. Pancreatic Lipase-Related Protein 2 (PNLIPRP2) is a secreted protein that belongs to the Lipase family of AB hydrolase superfamily. PNLIPRP2 is a lipase with broad substrate specificity that contains one PLAT domain. PNLIPRP2 is expressed mainly in pancreas. PNLIPRP2 can hydrolyze both phospholipids and galactolipids. PNLIPRP2 acts preferentially on monoglycerides, phospholipids and galactolipids. PNLIPRP2 also contributes to milk fat hydrolysis.
MW :51.16kD.
Recombinant Human Pancreatic Lipase-Related Protein 2 is produced by our Mammalian expression system and the target gene encoding Lys18-Cys469 is expressed with a 6His tag at the C-terminus. Pancreatic Lipase-Related Protein 2 (PNLIPRP2) is a secreted protein that belongs to the Lipase family of AB hydrolase superfamily. PNLIPRP2 is a lipase with broad substrate specificity that contains one PLAT domain. PNLIPRP2 is expressed mainly in pancreas. PNLIPRP2 can hydrolyze both phospholipids and galactolipids. PNLIPRP2 acts preferentially on monoglycerides, phospholipids and galactolipids. PNLIPRP2 also contributes to milk fat hydrolysis.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Tissue Specificity: | Pancreas. |
BioGrid: | 111409. 9 interactions. |
There are currently no product reviews
|