Recombinant Protein G
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 10 mg |
| Purification : | >96% as determined by SDS-PAGE and RP-HPLC. |
| Content : | Lyophilized white powder containing no additives. |
| Storage condition : | Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Protein G should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles. |
| AA sequence : | LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE. |
Source : Escherichia Coli The Protein G is a single, non-glycosylated protein contains 200 amino acids having a molecular mass of 21.8kDa. The Protein-G migrates on SDS-PAGE around 32kDa.
Reconstitution with deionized water or PBS.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|











.png)










