Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Human Fibrillin-1/Asprosin (N-8His)

Recombinant Human Fibrillin-1/Asprosin (N-8His)

Share:

Figure 1: SDS-PAGE - R (Reduced gel) , NR (Non-Reduced gel)

Recombinant Human Fibrillin-1/Asprosin (N-8His)

Roll over image to zoom in

   

Product code: 32-8842

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $376.00 

  • $642.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • More
  • Review   (0)
Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : HHHHHHHHSTNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH
Gene : FBN1
Gene ID : 2200
Uniprot ID : P35555

Source: Human Cells.
MW :17kD.
Recombinant Human Asprosin is produced by our Mammalian expression system and the target gene encoding Ser2732-His2871 is expressed with a 8His tag at the N-terminus. Asprosin is a protein hormone that is produced by white adipose tissue in mammals (and potentially by other tissues), which is then transported to the liver and stimulates it to release glucose into the blood stream. In the liver asprosin activates rapid glucose release by a cAMP-dependent pathway. The glucose release by the liver into the blood stream is vital for brain function and survival during fasting. People with neonatal progeroid syndrome lack asprosin, while people with insulin resistance have it in abundance. In animal tests asprosin showed potential for treating type 2 diabetes. When antibodies targeting asprosin were injected into diabetic mice, blood glucose and insulin levels improved.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
Post transnational modification: Fibrillin-1: Forms intermolecular disulfide bonds either with other fibrillin-1 molecules or with other components of the microfibrils.
BioGrid: 108494. 11 interactions.
There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-TIM3 Monoclonal Antibody (Clone:IHC003)

Anti-TIM3 Monoclonal Antibody ...

details-Anti-TIM3 Monoclonal Antibody (Clone:IHC003)
Anti-Human CD49D (Integrin alpha 4) (Natalizumab) – PE

Anti-Human CD49D (Integrin alp...

details-Anti-Human CD49D (Integrin alpha 4) (Natalizumab) – PE
Anti-CD38 antibody(DM28), Rabbit mAb

Anti-CD38 antibody(DM28), Rabb...

details-Anti-CD38 antibody(DM28), Rabbit mAb
Anti-HSP90 beta Monoclonal Antibody (Clone : Hyb-K3701) PerCP(Discontinued)

Anti-HSP90 beta Monoclonal Ant...

details-Anti-HSP90 beta Monoclonal Antibody (Clone : Hyb-K3701) PerCP(Discontinued)
Recombinant 2019-nCoV Spike RBD Protein His tag

Recombinant 2019-nCoV Spike RB...

details-Recombinant 2019-nCoV Spike RBD Protein His tag
Recombinant human IFNAR2 protein with C-terminal human Fc tag

Recombinant human IFNAR2 prote...

details-Recombinant human IFNAR2 protein with C-terminal human Fc tag
Anti-Human CD56 PE-DyLight® 594 (Clone : LT56)

Anti-Human CD56 PE-DyLight® 5...

details-Anti-Human CD56 PE-DyLight® 594 (Clone : LT56)
Peroxidase conjugated Donkey anti Goat IgG (H+L)

Peroxidase conjugated Donkey a...

details-Peroxidase conjugated Donkey anti Goat IgG (H+L)
AHSP Recombinant Protein

AHSP Recombinant Protein

details-AHSP Recombinant Protein
Anti-CD370 Antibody (Clone : 8F9)

Anti-CD370 Antibody (Clone : 8...

details-Anti-CD370 Antibody (Clone : 8F9)
Recombinant Human ACE2 His and FLAG Tag

Recombinant Human ACE2 His and...

details-Recombinant Human ACE2 His and FLAG Tag
CTDSPL Recombinant Protein

CTDSPL Recombinant Protein

details-CTDSPL Recombinant Protein
Anti-Tau Monoclonal Antibody (Clone:IHC696)-Ready to Use

Anti-Tau Monoclonal Antibody (...

details-Anti-Tau Monoclonal Antibody (Clone:IHC696)-Ready to Use
Anti-Dendra2 Antibody

Anti-Dendra2 Antibody

details-Anti-Dendra2 Antibody

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin

Related Products

CRYZ Recombinant Protein

CRYZ Recombinant Protein

Recombinant Tick-Borne Encephalitis Virus Core

Recombinant Tick-Borne Encephalitis Virus Core

Recombinant Human Calcitonin/CALCA (C-6His, E. coli)

Recombinant Human Calcitonin/CALCA (C-6His, E. coli)

New Products

C4a Human

C4a Human

Anti-B7-1 antibody(DM111), Rabbit mAb

Anti-B7-1 antibody(DM111), Rabbit mAb

Recombinant Human TXNDC5 Protein(C-His)

Recombinant Human TXNDC5 Protein(C-His)

close

Please Login to write a Review !!


close

Recombinant Human Fibrillin-1/Asprosin (N-8His)

Product code: 32-8842
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart