Recombinant Human Glutamine Synthetase/GLUL (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 200mM NaCl, 50mM Imidazole, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | TTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKNLEHHHHHH |
Source: E.coli.
MW :43.13kD.
Recombinant Human Glutamine Synthetase is produced by our E.coli expression system and the target gene encoding Thr2-Asn373 is expressed with a 6His tag at the C-terminus. Glutamine Synthetase reglutes intracellular concentration of glutamate. Glutamine Synthetase catalyzes the synthesis of glutamine from glutamate and ammonia. Glutamine is an important source of energy and that takes part in cell prolifetation, inhibition of apoptosis, and cell signaling. Glutamine Synthetase is expressed during early fetal stages, and has a role in maintaining body PH by removing ammonia from circulation. Mutations in the GLUL gene are related to congenital glutamine deficiency.
MW :43.13kD.
Recombinant Human Glutamine Synthetase is produced by our E.coli expression system and the target gene encoding Thr2-Asn373 is expressed with a 6His tag at the C-terminus. Glutamine Synthetase reglutes intracellular concentration of glutamate. Glutamine Synthetase catalyzes the synthesis of glutamine from glutamate and ammonia. Glutamine is an important source of energy and that takes part in cell prolifetation, inhibition of apoptosis, and cell signaling. Glutamine Synthetase is expressed during early fetal stages, and has a role in maintaining body PH by removing ammonia from circulation. Mutations in the GLUL gene are related to congenital glutamine deficiency.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Microsome, Mitochondrion, Cell membrane |
| Post transnational modification: | Ubiquitinated by ZNRF1. |
| Tissue Specificity: | Expressed in endothelial cells. |
| BioGrid: | 109014. 43 interactions. |
|
There are currently no product reviews
|









.png)








