Recombinant Human IL-10 Receptor Subunit beta/IL-10RB (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSVDHHHHHH |
Source: Human Cells.
MW :24.5kD.
Recombinant Human IL-10 Receptor beta is produced by our Mammalian expression system and the target gene encoding Met20-Ser220 is expressed with a 6His tag at the C-terminus. IL10RB is a single- pass type I membrane protein and contains two fibronectin type-III domains. It is an accessory chain which is essential for the active interleukin 10 receptor complex. Coexpression of IL10RB and IL10RA proteins has been shown to be required for IL10-induced signal transduction. Defects in IL10RB are the cause of inflammatory bowel disease type 25 (IBD25) which is a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology.
MW :24.5kD.
Recombinant Human IL-10 Receptor beta is produced by our Mammalian expression system and the target gene encoding Met20-Ser220 is expressed with a 6His tag at the C-terminus. IL10RB is a single- pass type I membrane protein and contains two fibronectin type-III domains. It is an accessory chain which is essential for the active interleukin 10 receptor complex. Coexpression of IL10RB and IL10RA proteins has been shown to be required for IL10-induced signal transduction. Defects in IL10RB are the cause of inflammatory bowel disease type 25 (IBD25) which is a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| BioGrid: | 109802. 3 interactions. |
|
There are currently no product reviews
|
















.png)











