Recombinant Human Magnesium-Dependent Phosphatase 1/MDP1 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEAVDHHHHHH |
Source: Human Cells.
MW :21.1kD.
Recombinant Human Magnesium-dependent phosphatase 1 is produced by our Mammalian expression system and the target gene encoding Met1-Ala176 is expressed with a 6His tag at the C-terminus. MDP1, which is short for nesium-dependent phosphatase 1, is a 176 aa. protein. It has 3 forms by different alternative splicing. This protein belongs to the HAD-like hydrolase superfamily, and usually takes its function with Magnesium. It can be inhibited by vanadate and zinc, and slightly by calcium. MDP1 is a Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.
MW :21.1kD.
Recombinant Human Magnesium-dependent phosphatase 1 is produced by our Mammalian expression system and the target gene encoding Met1-Ala176 is expressed with a 6His tag at the C-terminus. MDP1, which is short for nesium-dependent phosphatase 1, is a 176 aa. protein. It has 3 forms by different alternative splicing. This protein belongs to the HAD-like hydrolase superfamily, and usually takes its function with Magnesium. It can be inhibited by vanadate and zinc, and slightly by calcium. MDP1 is a Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| BioGrid: | 126921. 2 interactions. |
|
There are currently no product reviews
|
















.png)













