Recombinant Human Limbic System-Associated Membrane Protein/LSAMP (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINVDHHHHHH |
Source: Human Cells.
MW :32.8kD.
Recombinant Human LSAMP is produced by our Mammalian expression system and the target gene encoding Val29-Asn315 is expressed with a 6His tag at the C-terminus. Limbic system-associated membrane protein is also known as LSAMP, IgLON family member 3. In humans, it is encoded by the LSAMP gene. It belongs to the immunoglobulin superfamily and contains 3 Ig-like C2-type domains. Limbic system-associated membrane protein mediates selective neuronal growth and axon targeting. It contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. It is also essential for normal growth of the hyppocampal mossy fiber projection
MW :32.8kD.
Recombinant Human LSAMP is produced by our Mammalian expression system and the target gene encoding Val29-Asn315 is expressed with a 6His tag at the C-terminus. Limbic system-associated membrane protein is also known as LSAMP, IgLON family member 3. In humans, it is encoded by the LSAMP gene. It belongs to the immunoglobulin superfamily and contains 3 Ig-like C2-type domains. Limbic system-associated membrane protein mediates selective neuronal growth and axon targeting. It contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. It is also essential for normal growth of the hyppocampal mossy fiber projection
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Tissue Specificity: | Expressed on limbic neurons and fiber tracts as well as in single layers of the superior colliculus, spinal chord and cerebellum. |
| BioGrid: | 110223. 5 interactions. |
|
There are currently no product reviews
|











.png)








