Recombinant Human Osteocrin (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG |
Source: E.coli.
MW :14kD.
Recombinant Human Osteocrin is produced by our expression system and the target gene encoding Val28-Gly133 is expressed with a 6His tag at the N-terminus. Osteocrin is a secreted protein which is primarily expressed in bone and muscle. It is synthesized as a proprotein that undergoes proteolytic processing to generate a mature 50 amino acid C-terminal active peptide.Human Osteocrin proprotein shares 77% and 78% amino acid sequence identity with the rat and mouse protein, respectively. It appears to modulate osteoblastic differentiation. It could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle.
MW :14kD.
Recombinant Human Osteocrin is produced by our expression system and the target gene encoding Val28-Gly133 is expressed with a 6His tag at the N-terminus. Osteocrin is a secreted protein which is primarily expressed in bone and muscle. It is synthesized as a proprotein that undergoes proteolytic processing to generate a mature 50 amino acid C-terminal active peptide.Human Osteocrin proprotein shares 77% and 78% amino acid sequence identity with the rat and mouse protein, respectively. It appears to modulate osteoblastic differentiation. It could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Enriched in neocortical regions of the developing cerebral cortex (PubMed:27830782). Not expressed in other compartments of the neocortical wall or in brain regions such as the hippocampus, striatum, mediodorsal nucleus of the thalamus and cerebellum (PubMed:27830782). Also expressed in bone (PubMed:14523025). In developing neonatal rib bone, present at high level in osteoblasts on bone-forming surfaces, in newly incorporated osteocytes and in some late hypertrophic chondrocytes (at protein level) (PubMed:15923362). In adult bone, localizes specifically to osteoblasts and young osteocytes at bone-forming sites (at protein level) (PubMed:15923362). |
|
There are currently no product reviews
|












.png)












