Recombinant Human Parathyroid Hormone 1 Receptor/PTH1R (Gly49, C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | YALVDADDVMTKEEQIFLLHRAQAQCGKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMVDHHHHHH |
Source: Human Cells.
MW :20.2kD.
Recombinant Human Parathyroid hormone 1 receptor is produced by our Mammalian expression system and the target gene encoding Tyr23-Met189 is expressed with a 6His tag at the C-terminus. Parathyroid hormone 1 receptor(PTH1R) is a multi-pass membrane protein. The protein is expressed in high levels in bone and kidney and regulates calcium ionhomeostasis through activation of adenylate cyclase and phospholipase C. In bone, it is expressed on the surface of osteoblasts. When the receptor is activated through PTH binding, osteoblasts express RANKL (Receptor Activator of Nuclear Factor kB Ligand), which binds to RANK (Receptor Activator of Nuclear Factor kB) on osteoclasts. This turns on osteoclasts to ultimately increase the resorption rate.
MW :20.2kD.
Recombinant Human Parathyroid hormone 1 receptor is produced by our Mammalian expression system and the target gene encoding Tyr23-Met189 is expressed with a 6His tag at the C-terminus. Parathyroid hormone 1 receptor(PTH1R) is a multi-pass membrane protein. The protein is expressed in high levels in bone and kidney and regulates calcium ionhomeostasis through activation of adenylate cyclase and phospholipase C. In bone, it is expressed on the surface of osteoblasts. When the receptor is activated through PTH binding, osteoblasts express RANKL (Receptor Activator of Nuclear Factor kB Ligand), which binds to RANK (Receptor Activator of Nuclear Factor kB) on osteoclasts. This turns on osteoclasts to ultimately increase the resorption rate.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
|
There are currently no product reviews
|















.png)









