Recombinant Human Ribonuclease K6/RNASE6 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,1mMDTT,10%Glycerol,pH7.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSILVDHHHHHH |
Source: Human Cells.
MW :15.69kD.
Recombinant Human Ribonuclease K6 is produced by our Mammalian expression system and the target gene encoding Trp24-Leu150 is expressed with a 6His tag at the C-terminus. Ribonuclease K6 (RNASE6) is a secreted protein that belongs to the pancreatic ribonuclease family. Human RNASE6 is synthesized as a 150 amino acid precursor that contains a 23 amino acid signal sequence, and a 127 amino acid mature chain. RNASE6 is expressed in many tissues, with high expression levels in the lung, with lower expression levels in the heart, placenta, kidney, pancreas, liver, brain, and skeletal muscle. It is also detected in monocytes and neutrophils. RNASE6 may have a role in host defense.
MW :15.69kD.
Recombinant Human Ribonuclease K6 is produced by our Mammalian expression system and the target gene encoding Trp24-Leu150 is expressed with a 6His tag at the C-terminus. Ribonuclease K6 (RNASE6) is a secreted protein that belongs to the pancreatic ribonuclease family. Human RNASE6 is synthesized as a 150 amino acid precursor that contains a 23 amino acid signal sequence, and a 127 amino acid mature chain. RNASE6 is expressed in many tissues, with high expression levels in the lung, with lower expression levels in the heart, placenta, kidney, pancreas, liver, brain, and skeletal muscle. It is also detected in monocytes and neutrophils. RNASE6 may have a role in host defense.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Strong expression in lung, followed by heart, placenta, kidney, pancreas, liver, brain and skeletal muscle. Also expressed in monocytes and neutrophils. |
| BioGrid: | 111968. 1 interactions. |
|
There are currently no product reviews
|











.png)








