Recombinant Human T-cell Immunoglobulin and Mucin Domain-containing Protein 4/Tim-4 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | ETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQLHHHHHH |
Source: Human Cells.
MW :32.3kD.
Recombinant Human T-cell Immunoglobulin and Mucin Domain-containing Protein 4 is produced by our Mammalian expression system and the target gene encoding Glu25-Leu315 is expressed with a 6His tag at the C-terminus. T-cell Immunoglobulin and Mucin Domain-containing Protein 4(TIM-4) belongs to the immunoglobulin superfamily, is a member of the TIM family of immune regulating proteins. TIMs are type I transmembrane proteins with one Ig-like V domain and one Ser/Thr-rich mucin domain. Structurally, TIM-4 is distinguished from other TIMs by the presence of an RGD motif in its Ig domain and the lack of a site for tyrosine phosphorylation in its cytoplasmic tail. The mucin domain in TIM-4 is larger than in TIM-1 or TIM-3. TIM-4 is expressed by macrophages and mature dendritic cells but not by lymphocytes. it is Involved in regulating T-cell proliferation and lymphotoxin signaling.The interaction of TIM-4 with TIM-1 induces costimulatory and hyperproliferative signals in T cells. TIM-4 binds specifically to TIM-1 which is also the cellular receptor for the hepatitis A virus, and has been implicated in the development of asthma.
MW :32.3kD.
Recombinant Human T-cell Immunoglobulin and Mucin Domain-containing Protein 4 is produced by our Mammalian expression system and the target gene encoding Glu25-Leu315 is expressed with a 6His tag at the C-terminus. T-cell Immunoglobulin and Mucin Domain-containing Protein 4(TIM-4) belongs to the immunoglobulin superfamily, is a member of the TIM family of immune regulating proteins. TIMs are type I transmembrane proteins with one Ig-like V domain and one Ser/Thr-rich mucin domain. Structurally, TIM-4 is distinguished from other TIMs by the presence of an RGD motif in its Ig domain and the lack of a site for tyrosine phosphorylation in its cytoplasmic tail. The mucin domain in TIM-4 is larger than in TIM-1 or TIM-3. TIM-4 is expressed by macrophages and mature dendritic cells but not by lymphocytes. it is Involved in regulating T-cell proliferation and lymphotoxin signaling.The interaction of TIM-4 with TIM-1 induces costimulatory and hyperproliferative signals in T cells. TIM-4 binds specifically to TIM-1 which is also the cellular receptor for the hepatitis A virus, and has been implicated in the development of asthma.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
|
There are currently no product reviews
|


















.png)










