Recombinant Human THSD1/TMTSP (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNIVDHHHHHH |
Source: Human Cells.
MW :38.83kD.
Recombinant Human THSD1 is produced by our Mammalian expression system and the target gene encoding Glu25-Ile361 is expressed with a 6His tag at the C-terminus. Thrombospondin Type-1 Domain-Containing Protein 1 (THSD1) is a single-pass type I membrane protein. THSD1 contains a signal peptide and one TSP type-1 domain that is found in thrombospondin. THSD1 is a good novel candidate for TSG as it has been mapped to 13q14. Alternatively spliced transcript variants encoding distinct isoforms have been observed. THSD1 may be involved in the complement pathway.
MW :38.83kD.
Recombinant Human THSD1 is produced by our Mammalian expression system and the target gene encoding Glu25-Ile361 is expressed with a 6His tag at the C-terminus. Thrombospondin Type-1 Domain-Containing Protein 1 (THSD1) is a single-pass type I membrane protein. THSD1 contains a signal peptide and one TSP type-1 domain that is found in thrombospondin. THSD1 is a good novel candidate for TSG as it has been mapped to 13q14. Alternatively spliced transcript variants encoding distinct isoforms have been observed. THSD1 may be involved in the complement pathway.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
|
There are currently no product reviews
|













.png)









