Recombinant Mouse Cathepsin B/CTSB (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRFVDHHHHHH |
Source: Human Cells.
MW :36.4kD.
Recombinant Mouse Cathepsin B is produced by our Mammalian expression system and the target gene encoding His18-Phe339 is expressed with a 6His tag at the C-terminus. Cathepsin B (CatB) is an enzymatic protein belonging to the peptidase (or protease) families. which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.
MW :36.4kD.
Recombinant Mouse Cathepsin B is produced by our Mammalian expression system and the target gene encoding His18-Phe339 is expressed with a 6His tag at the C-terminus. Cathepsin B (CatB) is an enzymatic protein belonging to the peptidase (or protease) families. which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Lysosome, Melanosome, Secreted |
| BioGrid: | 198968. 3 interactions. |
|
There are currently no product reviews
|








.png)












