Recombinant Mouse Fc gamma RIIIA/FCGR3/CD16 (C-6His,Q5D5I8)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSVRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTHHHHHH |
| Gene : | Fcgr3 |
| Uniprot ID : | Q5D5I8 |
Source: Human cells.
MW :21.9kD.
Recombinant Mouse Fc gamma receptor III is produced by our Mammalian expression system and the target gene encoding Leu32-Thr215 is expressed with a 6His tag at the C-terminus. Low affinity immunoglobulin gamma Fc region receptor III (Fc gamma RIII/CD16) is a member of the Ig superfamily. Based on close relationships in their extracellular domains, the Fc gamma Rs have been divided into three classes composing of Fc gamma RI (CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16). Each group may be encoded by multiple genes and exist in different isoforms depending on species and cell type. Mouse CD16 is a type I transmembrane protein having two extracellular Ig-like domains consisting of immunoglobulin domain, repeat, signa and transmembrane, transmembrane helix. It is expressed on a variety of myeloid and lymphoid cells and associates with Fc R gamma to deliver an activating signal upon ligand binding. Fcgr3 is IgG binding and activation or inhibition of immune responses such as antibody-dependent cellular cytotoxicity, phagocytosis, cell surface receptor signaling pathway and positive regulation of type I/IIa/III hypersensitivity.
MW :21.9kD.
Recombinant Mouse Fc gamma receptor III is produced by our Mammalian expression system and the target gene encoding Leu32-Thr215 is expressed with a 6His tag at the C-terminus. Low affinity immunoglobulin gamma Fc region receptor III (Fc gamma RIII/CD16) is a member of the Ig superfamily. Based on close relationships in their extracellular domains, the Fc gamma Rs have been divided into three classes composing of Fc gamma RI (CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16). Each group may be encoded by multiple genes and exist in different isoforms depending on species and cell type. Mouse CD16 is a type I transmembrane protein having two extracellular Ig-like domains consisting of immunoglobulin domain, repeat, signa and transmembrane, transmembrane helix. It is expressed on a variety of myeloid and lymphoid cells and associates with Fc R gamma to deliver an activating signal upon ligand binding. Fcgr3 is IgG binding and activation or inhibition of immune responses such as antibody-dependent cellular cytotoxicity, phagocytosis, cell surface receptor signaling pathway and positive regulation of type I/IIa/III hypersensitivity.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|















.png)










