Recombinant Mouse S100 Calcium Binding Protein A15A/S100A15A
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTEHSLY |
Source: E.coli.
MW :12.9kD.
Recombinant Mouse S100 calcium binding protein A15A is produced by our E.coli expression system and the target gene encoding Met1-Tyr108 is expressed.
MW :12.9kD.
Recombinant Mouse S100 calcium binding protein A15A is produced by our E.coli expression system and the target gene encoding Met1-Tyr108 is expressed.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|










.png)











