Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Immune-Check Point
    4. /
    5. CTLA4 Stable Cell Line

    CTLA4 Stable Cell Line

    Share:

    Fig-1: Detection of human CTLA4 in the CHO-K1/CTLA4 stable cell line by Flow Cytometry [Cell surface staining]. CHO-K1 cells (Green); CHO-K1/CTLA4 cells (Red).

    CTLA4 Stable Cell Line

    Roll over image to zoom in

       

    Product code: 14-506ACL

    Application : Functional Assay

    Shipping Info:

    Order now and get it on Tuesday July 05, 2022

    Same day delivery FREE on San Diego area orders placed by 1.00 PM

    Local delivery areas

    Same-day delivery in San Diego available for the following zip codes:

    92121, 92122, 92037, 92117, 92109, 92110, 92101, 92010, 92011, 92009, 92008
    Download TDS / Manual MSDS
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price
    1 Vial
    $2,750.00 

    Add to Wish List

    Bulk Order

    Shipping Info:

    Order now and get it on Tuesday July 05, 2022

    Same day delivery FREE on San Diego area orders placed by 1.00 PM

    Download TDS / Manual MSDS

    • Product Info
    • Description
    • Application Note
    • Review   (0)
    Amount : 1 Vial
    Content : Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO.
    Storage condition : Immediately upon receipt, store in liquid nitrogen.

    CTLA4 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Cytotoxic T-Lymphocyte-Associated Protein 4 (CTLA4, also known as CD152).

    Sequence data: hCTLA4 (accession number NP_005202)

    MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY
    ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR
    AMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL
    LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
     
     

    Application:.

    •  Screen for antibodies of human CTLA4 through Flow Cytometry. 

    Culture conditions:

    Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1% Pen/Strep, plus 10 µg/ml of Blasticidin.
     
    It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator.
     
    Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence.
     
    To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
     
     
     

    LIMITED USE RESTRICTIONS:

    THIS PRODUCT IS SOLELY FOR IN VITRO RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE.

    By use of this product, user agrees to be bound by the terms of this limited use statement.

    This product is solely for Internal Research Purposes and not for Commercial Purposes. Commercial Purposes include, but are not limited to (1) use of the cell line in manufacturing; (2) use of the cell line to provide a service, information or data; (3) use of the cell line for therapeutic, diagnostic or prophylactic purposes; or (4) resale of the cell line whether or not such cell lines are resold for use in research. The buyer CANNOT sell, give or otherwise transfer this product to a third party.

    Commercial License Agreement is available for non-research/ non-inhouse/ commercial use if applicable. Please contact Abeomics (info@abeomics.com).

     

     

    For Research Use Only. Not for use in diagnostic/therapeutics procedures.

    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    Anti-CD56 Monoclonal Antibody (Clone:IHC056)

    Anti-CD56 Monoclonal Antibody ...

    details-Anti-CD56 Monoclonal Antibody (Clone:IHC056)
    Monoclonal Antibody to SARS-CoV-2 nucleocapsid (Clone: ABM4H11.1C12)

    Monoclonal Antibody to SARS-Co...

    details-Monoclonal Antibody to SARS-CoV-2 nucleocapsid (Clone: ABM4H11.1C12)
    Anti-Human CD274 Low Endotoxin Antibody (Clone : 29E.2A3)

    Anti-Human CD274 Low Endotoxin...

    details-Anti-Human CD274 Low Endotoxin Antibody (Clone : 29E.2A3)
    Anti-CD3 Monoclonal Antibody (Clone:IHC534)

    Anti-CD3 Monoclonal Antibody (...

    details-Anti-CD3 Monoclonal Antibody (Clone:IHC534)
    Anti-Actin, Smooth Muscle Monoclonal Antibody (Clone:IHC506)-Ready to Use

    Anti-Actin, Smooth Muscle Mono...

    details-Anti-Actin, Smooth Muscle Monoclonal Antibody (Clone:IHC506)-Ready to Use
    Monoclonal Antibody to Human CD180 (Clone-MHR73)

    Monoclonal Antibody to Human C...

    details-Monoclonal Antibody to Human CD180 (Clone-MHR73)
    Anti-MICA/MICB APC (Clone : 6D4)

    Anti-MICA/MICB APC (Clone : 6D...

    details-Anti-MICA/MICB APC (Clone : 6D4)
    Anti-Human CTLA-4 (Ipilimumab)

    Anti-Human CTLA-4 (Ipilimumab)

    details-Anti-Human CTLA-4 (Ipilimumab)
    Monoclonal Antibody to p53 (Clone BP53-12)

    Monoclonal Antibody to p53 (Cl...

    details-Monoclonal Antibody to p53 (Clone BP53-12)
    Monoclonal Antibody to Human/Mouse TLR2 (Clone : mT2.4)

    Monoclonal Antibody to Human/M...

    details-Monoclonal Antibody to Human/Mouse TLR2 (Clone : mT2.4)
    KLK3 Protein

    KLK3 Protein

    details-KLK3 Protein
    Anti-CD20 (rituximab biosimilar) (MS4A1)

    Anti-CD20 (rituximab biosimila...

    details-Anti-CD20 (rituximab biosimilar) (MS4A1)
    SARS-CoV-2 (2019-nCoV) Spike S1 (D614G) His Tag Protein

    SARS-CoV-2 (2019-nCoV) Spike S...

    details-SARS-CoV-2 (2019-nCoV) Spike S1 (D614G) His Tag Protein
    SARS-CoV-2 Spike S1 Mutant Sampler Set

    SARS-CoV-2 Spike S1 Mutant Sam...

    details-SARS-CoV-2 Spike S1 Mutant Sampler Set

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    Monoclonal Antibody to Human CD70 (Clone: BU69)

    Monoclonal Antibody to Human CD70 (Clone: BU69)

    PD-L1 Stable Cell Line

    PD-L1 Stable Cell Line

    Recombinant Human PD-1 rabbit monoclonal Antibody (Clone: ABMRR01)

    Recombinant Human PD-1 rabbit monoclonal Antibody (Clone: ABMRR01)

    close

    Please Login to write a Review !!


    close

    CTLA4 Stable Cell Line

    Product code: 14-506ACL
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart