Recombinant Human Cocaine- and Amphetamine-Regulated Transcript/CARTPT (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCLVDHHHHHH |
Source: Human Cells.
MW :10.98kD.
Recombinant Human CARTPT is produced by our Mammalian expression system and the target gene encoding Gln28-Leu116 is expressed with a 6His tag at the C-terminus. Cocaine- and Amphetamine-Regulated Transcript Protein (CARTPT) is a secreted protein that belongs to the CART family. CARTPT is detected in neurons of the ventrolateral part of the arcuate nucleus, in the external zone of the median eminence, and also found in terminals in the periventricular part of the paraventricular nucleus. CARTPT is processed by prohormone/proprotein convertases to produce smaller, biologically active peptides. CARTPT is a satiety factor closely associated with the actions of leptin and neuropeptide Y. This anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. CARTPT promotes neuronal development and survival in vitro.
MW :10.98kD.
Recombinant Human CARTPT is produced by our Mammalian expression system and the target gene encoding Gln28-Leu116 is expressed with a 6His tag at the C-terminus. Cocaine- and Amphetamine-Regulated Transcript Protein (CARTPT) is a secreted protein that belongs to the CART family. CARTPT is detected in neurons of the ventrolateral part of the arcuate nucleus, in the external zone of the median eminence, and also found in terminals in the periventricular part of the paraventricular nucleus. CARTPT is processed by prohormone/proprotein convertases to produce smaller, biologically active peptides. CARTPT is a satiety factor closely associated with the actions of leptin and neuropeptide Y. This anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. CARTPT promotes neuronal development and survival in vitro.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Hypothalamus. Found in neurons of the ventrolateral part of the arcuate nucleus, in the external zone of the median eminence, and also found in terminals in the periventricular part of the paraventricular nucleus. |
| BioGrid: | 114970. 45 interactions. |
|
There are currently no product reviews
|








.png)









