Recombinant Human CTHRC1/NMTC1 (C-6His) in 293HEK cells
Fig 1: SDS-PAGE analysis of Recombinant Human CTHRC1/NMTC1 (C-6His) 293 HEK cells. R lane is in reducing conditions, NR for non-reducing.
Roll over image to zoom in
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPKVDHHHHHH |
Source: Human Cells.
MW :24.1kD.
Recombinant Human CTHRC1 in 293 HEK mammalian expression system and the target gene encoding Ser31-Lys243 is expressed with a 6His tag at the C-terminus. Collagen triple helix repeat-containing protein 1 is a protein that in humans is encoded by the CTHRC1 gene. It acts as a negative regulator of collagen matrix deposition. It may cause the disease of Barrett esophagus . Patients with Barrett esophagus have an increased risk of esophageal adenocarcinoma. The main cause of Barrett esophagus is gastroesophageal reflux. The retrograde movement of acid and bile salts from the stomach into the esophagus causes prolonged injury to the esophageal epithelium and induces chronic esophagitis, which in turn is believed to trigger the pathologic changes.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | N-glycosylated. |
| Tissue Specificity: | Isoform 1 is expressed in calcified atherosclerotic plaque and chondrocyte-like cells. |
| BioGrid: | 125461. 1 interactions. |
|
There are currently no product reviews
|










.png)









