Recombinant PDGF Protein

Product code: 21-6005

Shipping Info:

Order now and get it on Tuesday April 07, 2026

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
50 μg
$450.00 

Add to Wish List

Shipping Info:

Order now and get it on Tuesday April 07, 2026

Same day delivery FREE on San Diego area orders placed by 1.00 PM


Amount : 50 μg
Purification : Greater than 98.0% as determined by SDS-PAGE.
Content : Insulin Like Growth Factor binding proteins 1is supplied as solution in 50 mM Tris, pH-7.5, 300 mM NaCl and 20% Sucrose.
Storage condition : Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time.Please avoid freeze thaw cycles.
AA sequence : MAKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIP GSPEIRGDPNCQILEHHHHHH

SourceE. coli.  MW: ~16.2kDa.

Endo Toxin : <2.0 EU/mg. This product are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.


 

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products