Recombinant PDGF Protein
Figure-1: SDS-PAGE analysis of purified Recombinant IGF B1 Protein was run on a 4-20% Gradient SDS-PAGE (Reducing) gel followed by Coomassie blue staining.
Roll over image to zoom in
Shipping Info:
Order now and get it on Tuesday April 07, 2026
Same day delivery FREE on San Diego area orders placed by 1.00 PM
| Amount : | 50 μg |
| Purification : | Greater than 98.0% as determined by SDS-PAGE. |
| Content : | Insulin Like Growth Factor binding proteins 1is supplied as solution in 50 mM Tris, pH-7.5, 300 mM NaCl and 20% Sucrose. |
| Storage condition : | Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time.Please avoid freeze thaw cycles. |
| AA sequence : | MAKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIP GSPEIRGDPNCQILEHHHHHH |
Source: E. coli. MW: ~16.2kDa.
Endo Toxin : <2.0 EU/mg. This product are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|

















.png)










