SARS CoV2 Spike S1 C-Term His Tag Protein
Figure-1: SDS-PAGE analysis of purified Recombinant EGF Protein was run on a 4-20% Gradient SDS-PAGE (Reducing) gel followed by Coomassie blue staining.
Roll over image to zoom in
Shipping Info:
Order now and get it on Tuesday April 07, 2026
Same day delivery FREE on San Diego area orders placed by 1.00 PM
| Amount : | 50 μg |
| Content : | 50 mM Tris, pH-8.0, 150 mM NaCl, 10% Glycerol. |
| Storage condition : | Store at–20°C |
| AA sequence : | MDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSGMAINWINEEVIWSNQQEGIITVTDMKGNNSHILLSALKY PANVAVDPVERFIFWSSEVAGSLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLEHHHHHH |
Source: Covid 19 Spike S1-His in CHO-K1.The spike protein (S1) of coronavirus (CoV2) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.
|
There are currently no product reviews
|















.png)










