SARS CoV2 Spike S1 C-Term His Tag Protein

Product code: 21-6003

Shipping Info:

Order now and get it on Tuesday April 07, 2026

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
50 μg
$450.00 

Add to Wish List

Shipping Info:

Order now and get it on Tuesday April 07, 2026

Same day delivery FREE on San Diego area orders placed by 1.00 PM


Amount : 50 μg
Content : 50 mM Tris, pH-8.0, 150 mM NaCl, 10% Glycerol.
Storage condition : Store at–20°C
AA sequence : MDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSGMAINWINEEVIWSNQQEGIITVTDMKGNNSHILLSALKY PANVAVDPVERFIFWSSEVAGSLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLEHHHHHH

Source: Covid 19 Spike S1-His in CHO-K1.The spike protein (S1) of coronavirus (CoV2) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.

There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products