Recombinant Human Cytoglobin/CYGB (C-6His)

Product code: 32-7106

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $376.00 

  • $579.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 10% Glycerol, pH 8.0 .
Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
AA sequence : MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGPLEHHHHHH
Gene : CYGB
Gene ID : 114757
Uniprot ID : Q8WWM9
Source: E.coli.
MW :22.44kD.
Recombinant Human Cytoglobin is produced by our E.coli expression system and the target gene encoding Met1-Pro190 is expressed with a 6His tag at the C-terminus. Cytoglobin is a ubiquitously globin protein that belongs to the globin family. The highest expressed in heart, stomach, bladder and small intestine. CYGB acts a protector under conditions of oxidative stress. CYGB may be involved in intracellular oxygen storage or transfer, modulates oxygen and nitric oxide metabolism or scavenging free radicals within a cell.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Cytoplasm
Tissue Specificity: Ubiquitously expressed. Highest expression in heart, stomach, bladder and small intestine.
BioGrid: 125335. 4 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products