Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Human Parvulin-14/PIN4 (N-6His)

Recombinant Human Parvulin-14/PIN4 (N-6His)

Share:

Recombinant Human Parvulin-14/PIN4 (N-6His)

Roll over image to zoom in

   

Product code: 32-8240

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $325.00 

  • $499.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • More
  • Review   (0)
Amount : 50 µg
Content : Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
AA sequence : MGSSHHHHHHSSGLVPRGSHMPMAGLLKGLVRQLEQFRVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Gene : PIN4
Gene ID : 5303
Uniprot ID : Q9Y237

Source: E. coli.
MW :18.8kD.
Recombinant Human Parvulin-14 is produced by our E.coli expression system and the target gene encoding Met1-Lys156 is expressed with a 6His tag at the N-terminus. Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4(PIN4) is a peptidyl-prolyl cis/trans isomerase (PPIase) which interacts with NIMA and is vital for cell cycle regulation. PIN4 has 2 different isoforms: PAR14 and PAR17. Furthermore, PIN4 protein binds to double-stranded DNA under physiological salt conditions. PIN4 is involved as a ribosomal RNA processing factor in ribosome biogenesis. The PAR14 binds to tightly bent AT-rich stretches of double-stranded DNA, but PAR17 binds to double-stranded DNA.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Mitochondrion, Mitochondrion matrix
Post transnational modification: Isoform 2 is sumoylated with SUMO2 and SUMO3.
Tissue Specificity: Isoform 2 is much more stable than isoform 1 (at protein level). Ubiquitous. Isoform 1 and isoform 2 are expressed in kidney, liver, blood vessel, brain, mammary gland, skeletal muscle, small intestine and submandibularis. Isoform 1 transcripts are much more abundant than isoform 2 in each tissue analyzed.
BioGrid: 111320. 33 interactions.
There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-Cytokeratin 18 Monoclonal Antibody (Clone:DC-10)-Biotin Conjugated

Anti-Cytokeratin 18 Monoclonal...

details-Anti-Cytokeratin 18 Monoclonal Antibody (Clone:DC-10)-Biotin Conjugated
Anti-Cdk1 / p34Cdc2 Monoclonal Antibody (Clone:POH-1)

Anti-Cdk1 / p34Cdc2 Monoclonal...

details-Anti-Cdk1 / p34Cdc2 Monoclonal Antibody (Clone:POH-1)
Anti-HSP90 alpha Monoclonal Antibody (Clone : Hyb-K41009) HRP(Discontinued)

Anti-HSP90 alpha Monoclonal An...

details-Anti-HSP90 alpha Monoclonal Antibody (Clone : Hyb-K41009) HRP(Discontinued)
IL-2 Superkine (Fc)  [IL-2 (human):Fc (human) (Recombinant)]

IL-2 Superkine (Fc) [IL-2 (hu...

details-IL-2 Superkine (Fc)  [IL-2 (human):Fc (human) (Recombinant)]
Chicken IgY Control (Whole Molecule), Purified(Discontinued)

Chicken IgY Control (Whole Mol...

details-Chicken IgY Control (Whole Molecule), Purified(Discontinued)
Monoclonal Antibody to human CD14

Monoclonal Antibody to human C...

details-Monoclonal Antibody to human CD14
rhProcalcitonin Recombinant Protein

rhProcalcitonin Recombinant Pr...

details-rhProcalcitonin Recombinant Protein
TCF/LEF Leeporter™ Luciferase Reporter-HEK293 Cell Line

TCF/LEF Leeporter™ Luciferas...

details-TCF/LEF Leeporter™ Luciferase Reporter-HEK293 Cell Line
Recombinant human ROBO1 protein with C-terminal human Fc tag

Recombinant human ROBO1 protei...

details-Recombinant human ROBO1 protein with C-terminal human Fc tag
Monoclonal Antibody to Human CD51/CD61 (Integrin alpha v beta 3) NALE™ Purified (Clone: 23C6)

Monoclonal Antibody to Human C...

details-Monoclonal Antibody to Human CD51/CD61 (Integrin alpha v beta 3) NALE™ Purified (Clone: 23C6)
Mouse Monoclonal Antibody to Human RPL17 (Clone : 15B3F5)(Discontinued)

Mouse Monoclonal Antibody to H...

details-Mouse Monoclonal Antibody to Human RPL17 (Clone : 15B3F5)(Discontinued)
VISTA Stable Cell Line-H

VISTA Stable Cell Line-H

details-VISTA Stable Cell Line-H
Recombinant human Trop2 protein with C-terminal mouse Fc and 6×His tag

Recombinant human Trop2 protei...

details-Recombinant human Trop2 protein with C-terminal mouse Fc and 6×His tag
Monoclonal Antibody to mouse VCAM-1

Monoclonal Antibody to mouse V...

details-Monoclonal Antibody to mouse VCAM-1

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin

Related Products

Human FGF10 / KGF2 Recombinant Protein(Discontinued)

Human FGF10 / KGF2 Recombinant Protein(Discontinued)

MCP 4 Recombinant Protein

MCP 4 Recombinant Protein

Recombinant Human Cadherin-1/E-cadherin/CDH1 (C-His)

Recombinant Human Cadherin-1/E-cadherin/CDH1 (C-His)

New Products

Anti-IL-17A (Taltz) (Ixekizumab biosimilar) mAb

Anti-IL-17A (Taltz) (Ixekizumab biosimilar) mAb

Recombinant TLR2 Protein with human Fc Tag

Recombinant TLR2 Protein with human Fc Tag

Recombinant TLR5 Protein with human Fc Tag

Recombinant TLR5 Protein with human Fc Tag

close

Please Login to write a Review !!


close

Recombinant Human Parvulin-14/PIN4 (N-6His)

Product code: 32-8240
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart